Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2420 [new locus tag: SAUSA300_RS13395 ]
  • pan locus tag?: SAUPAN006046000
  • symbol: SAUSA300_2420
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_2420 [new locus tag: SAUSA300_RS13395 ]
  • symbol: SAUSA300_2420
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2605945..2606364
  • length: 420
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCGAAAAAGAAAATTTTAATATTAACTAGTATTATGTTAATCATATTAATTAGTGTT
    GCAGGTATCTATTTAAAAGTGAAATATGACGAAAAAGAAAAACAAAAAGCAATATACTAT
    AAAGAACAACAAGCGCGCATTACACTTTATCTCAAGCATAACACTAAAGAACCGAATACA
    ATCAAATCTGTACATTTCACAAACTCGGAAACAAGTCCTATGGGAAGTGCTGTGATTGAA
    GGTTACATAAATGAAAACAAAAAAGATAATTTTACTGCTTATGCTACACCAGAACATAAT
    TATCAATTTGGTGGTGCTATGATAGAAAGTGAAAAATTAAGCGAGTTACTAAAGCCAGCC
    AATCAGTTAAAATCACCAGATGATATAAAAAAAGAACTAAATAAAAAGAAGAGTCACTAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_2420 [new locus tag: SAUSA300_RS13395 ]
  • symbol: SAUSA300_2420
  • description: hypothetical protein
  • length: 139
  • theoretical pI: 9.9502
  • theoretical MW: 15936.4
  • GRAVY: -0.626619

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108221: hypothetical protein 
  • PFAM:
    no clan definedDUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 128.5)
    Viral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 16)
    DUF4330; Domain of unknown function (DUF4330) (PF14221; HMM-score: 13.8)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.267
    • Ymax_pos: 30
    • Cmax: 0.199
    • Cmax_pos: 30
    • Smax: 0.718
    • Smax_pos: 5
    • Smean: 0.478
    • D: 0.349
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSKKKILILTSIMLIILISVAGIYLKVKYDEKEKQKAIYYKEQQARITLYLKHNTKEPNTIKSVHFTNSETSPMGSAVIEGYINENKKDNFTAYATPEHNYQFGGAMIESEKLSELLKPANQLKSPDDIKKELNKKKSH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]