From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00340 [old locus tag: SAUSA300_0067 ]
  • pan locus tag?: SAUPAN000816000
  • symbol: SAUSA300_RS00340
  • pan gene symbol?:
  • synonym:
  • product: universal stress protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS00340 [old locus tag: SAUSA300_0067 ]
  • symbol: SAUSA300_RS00340
  • product: universal stress protein
  • replicon: chromosome
  • strand: +
  • coordinates: 75565..75996
  • length: 432
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (75565..75996) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTCAAAAATATATTATTACCCTATGATTTCGAAAATGATTTTAGTGCTATCCCTGAC
    TATTTAGAAAAAGTCACCGATGAAGATTCAGTTGTTGTAATTTATCACGTTGTAACAGAA
    AATGATCTTGCAATTAGTGTCAAGTATTATAATAAGCATAAAGAAGATATTATTAGAGAA
    AAAGAGAAAAAACTCACTCCATTTTTACGTGAATTAGAAAAAAGAGATATTCAATATAAA
    ATAGATGTAGATTTTGGGCATATTAAAGATACAATCTTAGAAAAAATTACTTCTGGAGAT
    ATAAATAATGGTGAATTTGATTTAGTAATTATGAGTAATCATAGAGTCGATTTGAATATT
    AAACATGTTTTAGGAGATGTTACACATAAGATTGCTAAAAGAAGTTCTGTCCCAGTACTA
    ATTGTTAAATAA
    60
    120
    180
    240
    300
    360
    420
    432

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS00340 [old locus tag: SAUSA300_0067 ]
  • symbol: SAUSA300_RS00340
  • description: universal stress protein
  • length: 143
  • theoretical pI: 5.93942
  • theoretical MW: 16686.1
  • GRAVY: -0.318881

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    HUP (CL0039) Usp; Universal stress protein family (PF00582; HMM-score: 45.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 54
    • Cmax: 0.118
    • Cmax_pos: 45
    • Smax: 0.125
    • Smax_pos: 46
    • Smean: 0.071
    • D: 0.089
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446397950 NCBI
  • RefSeq: WP_000475805 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFKNILLPYDFENDFSAIPDYLEKVTDEDSVVVIYHVVTENDLAISVKYYNKHKEDIIREKEKKLTPFLRELEKRDIQYKIDVDFGHIKDTILEKITSGDINNGEFDLVIMSNHRVDLNIKHVLGDVTHKIAKRSSVPVLIVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS00340 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]