From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00355 [old locus tag: SAUSA300_0070 ]
  • pan locus tag?: SAUPAN000818000
  • symbol: SAUSA300_RS00355
  • pan gene symbol?:
  • synonym:
  • product: lysophospholipase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS00355 [old locus tag: SAUSA300_0070 ]
  • symbol: SAUSA300_RS00355
  • product: lysophospholipase
  • replicon: chromosome
  • strand: +
  • coordinates: 77130..77945
  • length: 816
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (77130..77945) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGCATTATATAAAATTTATTGAGTCAAAAGATAATACAAAACTTTATATGAAAGTGAAT
    GATATTCAAGATGCAAAAGCGAATATCATTATAGCTCATGGTGTGGCAGAACATTTAGAT
    CGTTATGATGAGATAACAGCATATTTAAATGAAGCGGGTTTTAGTGTTATTAGATATGAT
    CAAAGAGGGCATGGTCGTTCTGAAGGCAAGCGTGCCTTTTATAGCAATAGTAATGAAATT
    GTCGAAGATTTAGATGCGATAATAAATTATGTGAAGTCAAACTTTGAAGGTAAAGTTTAC
    TTAATCGGTCATAGTATGGGTGGTTATACAGTCACTTTATATGGAACGAAACATCCAAAT
    ACAGTGAATGGTATTATAACTTCTGGAGCATTAACACGTTATAATAATAAACTATTTGGC
    AATCCTGATAGAAACATATCACCTGATACTTATATAGAAAACAATTTAAGTGAGGGGGTA
    TGTTCTGATTTAGAGGTAATGGAAAAATATAAACTTGATGATTTGAATGCGAAACAAATC
    TCTATGGGGCTCGTCTTTTCAATAATGGATGGTGTTAGGTATTTGAAAGACAATGCTCAA
    CAATTTACAGATAATATTTTGATATTGCATGGCAAGGAAGATGGGCTAGTAAGCTATGTA
    GATTCTTTACAGCTTTATCAAGAAATAGGATCAGCACATAAATCATTACACATCTATGAT
    CGTTTGGAGCATGAAATATTTAATGAAAGTTCTTATAATAGAACTATTTTTAACGAAGTT
    ATTGAATGGCTTGAAACGGAATTAACTTATAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    816

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS00355 [old locus tag: SAUSA300_0070 ]
  • symbol: SAUSA300_RS00355
  • description: lysophospholipase
  • length: 271
  • theoretical pI: 4.9416
  • theoretical MW: 31038.5
  • GRAVY: -0.454244

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Plasmodium subtelomeric family (TIGR01607; HMM-score: 47.2)
    proline-specific peptidase (TIGR01250; HMM-score: 44.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 38.7)
    MetabolismEnergy metabolismOther3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 38)
    prolyl aminopeptidase (TIGR01249; EC 3.4.11.5; HMM-score: 32.1)
    pyrimidine utilization protein D (TIGR03611; HMM-score: 31.3)
    exosortase A system-associated hydrolase 1 (TIGR03100; HMM-score: 27.1)
    Unknown functionEnzymes of unknown specificityhydrolase CocE/NonD family protein (TIGR00976; HMM-score: 26.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinpimelyl-[acyl-carrier protein] methyl ester esterase (TIGR01738; EC 3.1.1.85; HMM-score: 25.6)
    2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (TIGR03343; EC 3.7.1.-; HMM-score: 22)
    MetabolismEnergy metabolismPhotosynthesisputative magnesium chelatase accessory protein (TIGR03056; HMM-score: 14.2)
    exosortase A system-associated hydrolase 2 (TIGR03101; HMM-score: 13.3)
    Cellular processesCellular processesDetoxificationS-formylglutathione hydrolase (TIGR02821; EC 3.1.2.12; HMM-score: 11.9)
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 201.9)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 68.1)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 42.9)
    Peptidase_S15; X-Pro dipeptidyl-peptidase (S15 family) (PF02129; HMM-score: 32)
    Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 29.7)
    Acyl_transf_2; Acyl transferase (PF02273; HMM-score: 29.6)
    DLH; Dienelactone hydrolase family (PF01738; HMM-score: 25.6)
    UPF0227; Uncharacterised protein family (UPF0227) (PF05728; HMM-score: 22.2)
    Abhydrolase_5; Alpha/beta hydrolase family (PF12695; HMM-score: 21.5)
    DUF915; Alpha/beta hydrolase of unknown function (DUF915) (PF06028; HMM-score: 18.8)
    PGAP1; PGAP1-like protein (PF07819; HMM-score: 18.2)
    LIDHydrolase; Lipid-droplet associated hydrolase (PF10230; HMM-score: 16.8)
    DUF1749; Protein of unknown function (DUF1749) (PF08538; HMM-score: 16.2)
    Abhydrolase_2; Phospholipase/Carboxylesterase (PF02230; HMM-score: 16.1)
    Ndr; Ndr family (PF03096; HMM-score: 15.5)
    LCAT; Lecithin:cholesterol acyltransferase (PF02450; HMM-score: 15)
    DUF900; Alpha/beta hydrolase of unknown function (DUF900) (PF05990; HMM-score: 14.5)
    Esterase; Putative esterase (PF00756; HMM-score: 14.4)
    Lipase_3; Lipase (class 3) (PF01764; HMM-score: 14.2)
    Tannase; Tannase and feruloyl esterase (PF07519; HMM-score: 14)
    no clan definedUPF0180; Uncharacterised protein family (UPF0180) (PF03698; HMM-score: 13.8)
    AB_hydrolase (CL0028) BAAT_C; BAAT / Acyl-CoA thioester hydrolase C terminal (PF08840; HMM-score: 13.1)
    Peptidase_S28; Serine carboxypeptidase S28 (PF05577; HMM-score: 11.9)
    DUF2048; Abhydrolase domain containing 18 (PF09752; HMM-score: 11.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.104
    • Ymax_pos: 28
    • Cmax: 0.123
    • Cmax_pos: 28
    • Smax: 0.141
    • Smax_pos: 1
    • Smean: 0.088
    • D: 0.098
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446481121 NCBI
  • RefSeq: WP_000558975 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MHYIKFIESKDNTKLYMKVNDIQDAKANIIIAHGVAEHLDRYDEITAYLNEAGFSVIRYDQRGHGRSEGKRAFYSNSNEIVEDLDAIINYVKSNFEGKVYLIGHSMGGYTVTLYGTKHPNTVNGIITSGALTRYNNKLFGNPDRNISPDTYIENNLSEGVCSDLEVMEKYKLDDLNAKQISMGLVFSIMDGVRYLKDNAQQFTDNILILHGKEDGLVSYVDSLQLYQEIGSAHKSLHIYDRLEHEIFNESSYNRTIFNEVIEWLETELTYN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS00355 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]