Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS05735
  • pan locus tag?:
  • symbol: SAUSA300_RS05735
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS05735
  • symbol: SAUSA300_RS05735
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1158358..1158639
  • length: 282
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (1158358..1158639) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    GTGACAGAAATAGTATTTTATAAAATTTATTTCGTTGTCACTCCCCAACTTGCACATTAT
    TGTAAGCTGACTTTTCGTCAGCTTCTGTGTTGGGGCCCACCCCAACTTGCATTGTCTGTA
    GAATTTCTTTTTGAAATTCTCTATGTTGGGGCCCCGCCTATAATTGAAAAATGCTTGTTA
    CATGGGCATTTTCATTCGGTCAACTACTACCAATATAATATTGTAGAGCCTAAGACATTG
    ATTTATTATGTCTTAGGCTCTATTCCTTCATTTAATGATTAA
    60
    120
    180
    240
    282

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS05735
  • symbol: SAUSA300_RS05735
  • description: hypothetical protein
  • length: 93
  • theoretical pI: 6.92336
  • theoretical MW: 10906.8
  • GRAVY: 0.427957

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF3125; Protein of unknown function (DUF3125) (PF11323; HMM-score: 30.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 32
    • Cmax: 0.155
    • Cmax_pos: 21
    • Smax: 0.172
    • Smax_pos: 23
    • Smean: 0.096
    • D: 0.107
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446058418 NCBI
  • RefSeq: WP_000136273 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTEIVFYKIYFVVTPQLAHYCKLTFRQLLCWGPPQLALSVEFLFEILYVGAPPIIEKCLLHGHFHSVNYYQYNIVEPKTLIYYVLGSIPSFND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS05735 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]