From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS10675 [old locus tag: SAUSA300_1946 ]
  • pan locus tag?: SAUPAN001382000
  • symbol: SAUSA300_RS10675
  • pan gene symbol?: —
  • synonym:
  • product: transcriptional activator RinB

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS10675 [old locus tag: SAUSA300_1946 ]
  • symbol: SAUSA300_RS10675
  • product: transcriptional activator RinB
  • replicon: chromosome
  • strand: -
  • coordinates: 2110992..2111141
  • length: 150
  • essential: unknown

⊟Accession numbers[edit source | edit]

  • Location: NC_007793 (2110992..2111141) NCBI
  • MicrobesOnline:

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGATTAAGCAAATACTAAGATTATTATTCTTACTAGCGATGTATGAGTTAGGTAAGTAT
    GTAACTGAGCAAGTATATATTATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGAT
    TACGTCTTTCGAGCGGAGGTAAGTGAGTGA
    60
    120
    150

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: SAUSA300_RS10675 [old locus tag: SAUSA300_1946 ]
  • symbol: SAUSA300_RS10675
  • description: transcriptional activator RinB
  • length: 49
  • theoretical pI: 4.07995
  • theoretical MW: 5748.7
  • GRAVY: 0.24898

⊟Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedRinB; Transcriptional activator RinB (PF06116; HMM-score: 86)

⊟Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

⊟Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.146
    • Ymax_pos: 11
    • Cmax: 0.11
    • Cmax_pos: 45
    • Smax: 0.256
    • Smax_pos: 1
    • Smean: 0.209
    • D: 0.171
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit source | edit]

  • GI: 446517919 NCBI
  • RefSeq: WP_000595265 NCBI
  • UniProt:

⊟Protein sequence[edit source | edit]

  • MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYVFRAEVSE

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

  • SAUSA300_RS10675 no polycistronic organisation predicted

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

⊟Relevant publications[edit source | edit]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_RS10675&oldid=75734"