From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS12600 [old locus tag: SAUSA300_2280 ]
  • pan locus tag?: SAUPAN005820000
  • symbol: SAUSA300_RS12600
  • pan gene symbol?: fosB
  • synonym:
  • product: metallothiol transferase FosB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS12600 [old locus tag: SAUSA300_2280 ]
  • symbol: SAUSA300_RS12600
  • product: metallothiol transferase FosB
  • replicon: chromosome
  • strand: +
  • coordinates: 2452433..2452852
  • length: 420
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (2452433..2452852) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTAAAATCTATTAATCATATATGCTTTTCAGTCAGAAATTTAAACGATTCAATACAT
    TTTTATAGAGATATTTTACTTGGGAAATTGCTATTGACTGGTAAAAAAACTGCTTATTTT
    GAGCTTGCAGGCCTATGGATTGCTTTAAATGAAGAAAAAGATATACCACGTAATGAAATT
    CACTTTTCATATACACATATAGCTTTCACTATAGATGACAGCGAATTTAAATATTGGCAT
    CAGAGGTTAAAAGATAATAACGTGAATATTTTAGAAGGAAGAGTTAGAGATATTAGAGAT
    AGACAATCAATTTACTTTACCGACCCTGATGGTCATAAGCTAGAATTACATACTGGCACA
    CTTGAGAACAGATTAAATTATTATAAAGAGGCTAAACCACATATGACATTTTACAAATAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

Protein Data Bank: 4NAY
Protein Data Bank: 4NAZ
Protein Data Bank: 4NB0
Protein Data Bank: 4NB1
Protein Data Bank: 4NB2

General[edit source | edit]

  • locus tag: SAUSA300_RS12600 [old locus tag: SAUSA300_2280 ]
  • symbol: SAUSA300_RS12600
  • description: metallothiol transferase FosB
  • length: 139
  • theoretical pI: 8.43846
  • theoretical MW: 16647.8
  • GRAVY: -0.591367

Function[edit source | edit]

  • reaction:
    EC 2.5.1.18?  ExPASy
    Glutathione transferaseRX + glutathione = HX + R-S-glutathione
  • TIGRFAM:
    MetabolismEnergy metabolismOtherlactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 26.1)
    MetabolismCentral intermediary metabolismAmino sugarslactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 26.1)
    MetabolismEnergy metabolismOthercatechol 2,3 dioxygenase (TIGR03211; EC 1.13.11.2; HMM-score: 19.9)
    methylmalonyl-CoA epimerase (TIGR03081; EC 5.1.99.1; HMM-score: 17.7)
    3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 17)
    MetabolismEnergy metabolismOther2,3-dihydroxybiphenyl 1,2-dioxygenase (TIGR03213; EC 1.13.11.39; HMM-score: 15.9)
    lactoylglutathione lyase family protein (TIGR03645; HMM-score: 12.7)
  • TheSEED:
  • PFAM:
    Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 50.6)
    Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 30.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.125
    • Ymax_pos: 11
    • Cmax: 0.112
    • Cmax_pos: 41
    • Smax: 0.217
    • Smax_pos: 4
    • Smean: 0.144
    • D: 0.132
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446842983 NCBI
  • RefSeq: WP_000920239 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLKSINHICFSVRNLNDSIHFYRDILLGKLLLTGKKTAYFELAGLWIALNEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYKEAKPHMTFYK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS12600 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]