Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14715 [old locus tag: SAUSA300_pUSA010004 ]
  • pan locus tag?:
  • symbol: SAUSA300_RS14715
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS14715 [old locus tag: SAUSA300_pUSA010004 ]
  • symbol: SAUSA300_RS14715
  • product: hypothetical protein
  • replicon: pUSA01
  • strand: -
  • coordinates: 2093..2674
  • length: 582
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007790 (2093..2674) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATGCAATTCAAAACAGTATATCACTAAGAAAGATTTTAGTAGTATCTTTAAGTATT
    TTAACCATACTTTCAATGGTCTTGGATTTTAATTTCAAAGAAGCTCAAGCCCAAAACAAA
    AATAACATTGCAGATAAAAACGTTGAAACTTTAAACGAAAAAGAAATTGAAAAAGAACTA
    AAATACATATATGGCAAAATTATTATTTTAGATAAAGACGGAACAGCTAAAGATGTTAAT
    CTAGAAAATGCCAAATCTCGATATGGATATGTTCCTGAAGGATTCCAAAAACTAAAAAAC
    GACATAGAGAATAAAAAGAAAACTAGTTCAATATCACCTAGAGCAGTTGGTGGGAACTAC
    AAAAATAGCGGTGACTGTTTCTATTCTGAAGTTTTAAACTCATATGGAGAACTTTTAACT
    GGAAACATAATCACAGCAGTTTTTGAAGATGTTAAAGCCAAAAACTTAAAGGGCGTAGCA
    AAAAAATTAGCTAAAATTGGGATAAAAGGAAACCTAGCTGGAATCGCAGCTACTATGGTT
    TCGAAGGATGTACAATGTAATCTTAAATACGGGTTACTTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    582

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS14715 [old locus tag: SAUSA300_pUSA010004 ]
  • symbol: SAUSA300_RS14715
  • description: hypothetical protein
  • length: 193
  • theoretical pI: 9.81203
  • theoretical MW: 21270.5
  • GRAVY: -0.235233

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF5469; Family of unknown function (DUF5469) (PF17561; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide length 38 aa
    • Ymax: 0.507
    • Ymax_pos: 38
    • Cmax: 0.346
    • Cmax_pos: 38
    • Smax: 0.872
    • Smax_pos: 27
    • Smean: 0.586
    • D: 0.538
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446914449 NCBI
  • RefSeq: WP_000991705 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNAIQNSISLRKILVVSLSILTILSMVLDFNFKEAQAQNKNNIADKNVETLNEKEIEKELKYIYGKIIILDKDGTAKDVNLENAKSRYGYVPEGFQKLKNDIENKKKTSSISPRAVGGNYKNSGDCFYSEVLNSYGELLTGNIITAVFEDVKAKNLKGVAKKLAKIGIKGNLAGIAATMVSKDVQCNLKYGLL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS14715 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]