From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
  • pan locus tag?:
  • symbol: SAUSA300_RS14790
  • pan gene symbol?:
  • synonym:
  • product: membrane protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
  • symbol: SAUSA300_RS14790
  • product: membrane protein
  • replicon: pUSA03
  • strand: +
  • coordinates: 11030..11347
  • length: 318
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007792 (11030..11347) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAAAAATTCAGTTTAACAACTGTTTATGTAGCATTTTTAAGCATTGTTTTATCA
    AATATAACACTTGGCGCAGAAAATCCAGGGCCGAAAATTGAACAAGGTTTACAACAAGTA
    CAAACATTCTTAACAGGCCTAATTGTTGCTGTTGGTATCTGTGCTGGTGTTTGGATAGTT
    CTTAAAAAATTACCTGGAATTGATGATCCAATGGTAAAAAATGAAATGTTTAGAGGCGTT
    GGAATGGTATTAGCTGGTGTGGCTGTTGGGGCAGCACTTGTTTGGTTGGTTCCATGGGTA
    TACAACCTTTTCCAATAA
    60
    120
    180
    240
    300
    318

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
  • symbol: SAUSA300_RS14790
  • description: membrane protein
  • length: 105
  • theoretical pI: 9.19725
  • theoretical MW: 11317.6
  • GRAVY: 0.862857

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedT4SS_CagC; Cag pathogenicity island, type IV secretory system (PF16943; HMM-score: 62.8)
    TrbC; TrbC/VIRB2 family (PF04956; HMM-score: 23.6)
    DUF2157; Predicted membrane protein (DUF2157) (PF09925; HMM-score: 21.1)
    Maff2; Maff2 family (PF12750; HMM-score: 14.2)
    SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 10.4)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 8.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.388
    • Ymax_pos: 27
    • Cmax: 0.251
    • Cmax_pos: 27
    • Smax: 0.714
    • Smax_pos: 20
    • Smean: 0.581
    • D: 0.463
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446514276 NCBI
  • RefSeq: WP_000591622 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIKKFSLTTVYVAFLSIVLSNITLGAENPGPKIEQGLQQVQTFLTGLIVAVGICAGVWIVLKKLPGIDDPMVKNEMFRGVGMVLAGVAVGAALVWLVPWVYNLFQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS14790 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]