From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14795 [old locus tag: SAUSA300_pUSA030012 ]
  • pan locus tag?:
  • symbol: SAUSA300_RS14795
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS14795 [old locus tag: SAUSA300_pUSA030012 ]
  • symbol: SAUSA300_RS14795
  • product: hypothetical protein
  • replicon: pUSA03
  • strand: +
  • coordinates: 11407..11814
  • length: 408
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007792 (11407..11814) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCTGTTGAGCAAGAAGTTAAAGATATAATGCTCGATATGTTGGGCGAAGAAAAGAAA
    GTTAAAGAGAATATAATACCTCGTAATGTAGACGCTAGTTATAAAATATTCTTAAATTTA
    AACGGTAAAGAATTAGCAATTGTATTTGTTCCTTTTTTACTATTTCTAACAATAGCATTT
    GGTGTAACGTTTTTAATGGGCTTACTTAATTTAATAACTGGCTTTATGGTTTTTATAGTA
    GGTTTGATTTTTGGTTTAACAATATATGGCTTACTAACAATTAGACCAATTAGTACAAAA
    GAAAATATAAGAATGATTGATACCATAAAACAATCACAACGATTTAGCAGAAGGCAGAAA
    GTTTACTTCTATAAAAGTAAAGAAGGATTGGGTGATGATGATGTTTAA
    60
    120
    180
    240
    300
    360
    408

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS14795 [old locus tag: SAUSA300_pUSA030012 ]
  • symbol: SAUSA300_RS14795
  • description: hypothetical protein
  • length: 135
  • theoretical pI: 9.41803
  • theoretical MW: 15476.3
  • GRAVY: 0.331852

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesintracellular adhesion protein D (TIGR03932; HMM-score: 11.2)
  • TheSEED:
  • PFAM:
    no clan definedPrgI; PrgI family protein (PF12666; HMM-score: 19.1)
    Phage_holin_3_6; Putative Actinobacterial Holin-X, holin superfamily III (PF07332; HMM-score: 15)
    YwcE; Spore morphogenesis and germination protein YwcE (PF17368; HMM-score: 14.3)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 13.7)
    DUF2149; Uncharacterized conserved protein (DUF2149) (PF09919; HMM-score: 13)
    Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 12.4)
    YuiB; Putative membrane protein (PF14068; HMM-score: 9.6)
    APC (CL0062) AA_permease_C; C-terminus of AA_permease (PF13906; HMM-score: 9.4)
    no clan definedPromethin; Promethin (PF16015; HMM-score: 7.3)
    DUF5469; Family of unknown function (DUF5469) (PF17561; HMM-score: 7.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.097
    • Ymax_pos: 24
    • Cmax: 0.114
    • Cmax_pos: 62
    • Smax: 0.122
    • Smax_pos: 17
    • Smean: 0.078
    • D: 0.09
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 446032302 NCBI
  • RefSeq: WP_000110157 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSVEQEVKDIMLDMLGEEKKVKENIIPRNVDASYKIFLNLNGKELAIVFVPFLLFLTIAFGVTFLMGLLNLITGFMVFIVGLIFGLTIYGLLTIRPISTKENIRMIDTIKQSQRFSRRQKVYFYKSKEGLGDDDV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS14795 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]