From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14855 [old locus tag: SAUSA300_pUSA030024 ]
  • pan locus tag?:
  • symbol: SAUSA300_RS14855
  • pan gene symbol?:
  • synonym:
  • product: IS6 family transposase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS14855 [old locus tag: SAUSA300_pUSA030024 ]
  • symbol: SAUSA300_RS14855
  • product: IS6 family transposase
  • replicon: pUSA03
  • strand: +
  • coordinates: 23299..23973
  • length: 675
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007792 (23299..23973) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTAC
    TATCTAAGATATGCATTGAGCTATCGTGATATATCTGAAATATTAAGAGAACGTGGTGTA
    AACGTTCATCATTCAACGATCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAA
    ATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATC
    AAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTA
    GATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTC
    ATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAAGTA
    GCAATAGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAA
    TATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGATAT
    CAAAGTATCAATACGGCAAAAAATACACTCAAAGGCATTGAATGTATTTACGCTCTATAT
    AAAAAGAACCGCAGATCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATC
    ATGCTAGCAAGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS14855 [old locus tag: SAUSA300_pUSA030024 ]
  • symbol: SAUSA300_RS14855
  • description: IS6 family transposase
  • length: 224
  • theoretical pI: 10.427
  • theoretical MW: 26881.2
  • GRAVY: -0.577232

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    RNase_H (CL0219) DDE_Tnp_IS240; DDE domain (PF13610; HMM-score: 133.6)
    and 11 more
    rve; Integrase core domain (PF00665; HMM-score: 54.9)
    DDE_Tnp_IS66; Transposase IS66 family (PF03050; HMM-score: 19.1)
    HTH (CL0123) HTH_32; Homeodomain-like domain (PF13565; HMM-score: 18.4)
    RNase_H (CL0219) DDE_3; DDE superfamily endonuclease (PF13358; HMM-score: 17.2)
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.4)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.9)
    no clan definedDUF1580; Protein of unknown function (DUF1580) (PF07618; HMM-score: 12.7)
    HTH (CL0123) HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.5)
    no clan definedMelibiase_2_C; Alpha galactosidase A C-terminal beta sandwich domain (PF17450; HMM-score: 12.3)
    HEM4; Uroporphyrinogen-III synthase HemD (PF02602; HMM-score: 11.3)
    HTH (CL0123) HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 7.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.12
    • Ymax_pos: 11
    • Cmax: 0.104
    • Cmax_pos: 45
    • Smax: 0.239
    • Smax_pos: 1
    • Smean: 0.128
    • D: 0.123
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447028694 NCBI
  • RefSeq: WP_001105950 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTIYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAIAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS14855 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]