From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 23-MAY-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_pUSA030006 [new locus tag: SAUSA300_RS14765 ]
  • pan locus tag?:
  • symbol: SAUSA300_pUSA030006
  • pan gene symbol?:
  • synonym:
  • product: replication and maintenance protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_pUSA030006 [new locus tag: SAUSA300_RS14765 ]
  • symbol: SAUSA300_pUSA030006
  • product: replication and maintenance protein
  • replicon: pUSA03
  • strand: +
  • coordinates: 6681..7157
  • length: 477
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAGAAAGATATGGAACAGTCTATAAAGGCTCTCAGAGGCTCATAGACGAAGAAAGT
    GGAGAAGTCATAGAGGTAGACAAGTTATACCGTAAACAAACGTCTGGTAACTTCGTAAAG
    GCATATATAGTGCAATTAATAAGTATGTTAGATATGATTGGCGGAAAAAAACTTAAAATC
    GTTAACTATATCCTAGATAATGTCCACTTAAGTAACAATACAATGATAGCTACAACAAGA
    GAAATAGCAAAAGCTACAGGAACAAGTCTACAAACAGTAATAACAACACTTAAAATCTTA
    GAAGAAGGAAATATTATAAAAAGAAAAACTGGAGTATTAATGTTAAACCCTGAACTACTA
    ATGAGAGGCGACGACCAAAAACAAAAATACCTCTTACTCGAATTTGGGAACTTTGAGCAA
    GAGGCAAATGAAAAACAAGAAAATGCATTATCTGATTATTATTCTTTCAAGGACTAG
    60
    120
    180
    240
    300
    360
    420
    477

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_pUSA030006 [new locus tag: SAUSA300_RS14765 ]
  • symbol: SAUSA300_pUSA030006
  • description: replication and maintenance protein
  • length: 158
  • theoretical pI: 7.49276
  • theoretical MW: 18078.7
  • GRAVY: -0.411392

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly SUF system regulator (TIGR02944; HMM-score: 13.8)
    Signal transductionRegulatory functionsDNA interactionsFeS assembly SUF system regulator (TIGR02944; HMM-score: 13.8)
  • TheSEED:  
    Replication and maintenance protein 
  • PFAM:
    HTH (CL0123) RepL; Firmicute plasmid replication protein (RepL) (PF05732; HMM-score: 233.3)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 25.1)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 24.6)
    FUR; Ferric uptake regulator family (PF01475; HMM-score: 17.1)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 16.4)
    MarR; MarR family (PF01047; HMM-score: 14.3)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 14)
    HTH_11; HTH domain (PF08279; HMM-score: 13.6)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 13.5)
    GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 13.4)
    FaeA; FaeA-like protein (PF04703; HMM-score: 12.8)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.105
    • Ymax_pos: 65
    • Cmax: 0.104
    • Cmax_pos: 21
    • Smax: 0.155
    • Smax_pos: 57
    • Smean: 0.074
    • D: 0.093
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQLISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGNIIKRKTGVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEKQENALSDYYSFKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • MicrobesOnline: SAUSA300_pUSA030006 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]