From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00020 [old locus tag: SAP005 ]
  • pan locus tag?:
  • symbol: SA_RS00020
  • pan gene symbol?:
  • synonym:
  • product: cadmium transporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00020 [old locus tag: SAP005 ]
  • symbol: SA_RS00020
  • product: cadmium transporter
  • replicon: pN315
  • strand: +
  • coordinates: 4501..5118
  • length: 618
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_003140 (4501..5118) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATTCAAACGGTTGTTGCTGCTGCTGTTCTTTATATTGCTACAGCAGTTGATTTATTA
    GTAATTTTATTAATATTTTTTGCTAGAGCAAAGACTAGAAAAGAATATAGAGATATTTAT
    GTTGGTCAATATTTAGGGTCTATTATTTTAATATTAGTTAGTTTGTTTTTAGCTTTTGTA
    TTAAATTATGTTCCAGAAAAGTGGATATTAGGTTTATTGGGTTTAATACCAATTTATCTT
    GGAATTAAAGTGGCTATTTATGATGATTGTGAAGGAGAAAAGAGAGCTAAAAAAGAATTG
    AATGAAAAAGGATTGTCTAAATTAGTTGGTACGGTTGCAATTGTTACGATAGCAAGTTGT
    GGCGCCGATAATATTGGTTTATTTGTTCCGTATTTTGTGACATTAAGTGTTACTAATTTA
    TTACTTACTCTGTTTGTCTTTTTAATTTTAATTTTCTTCTTGGTGTTTACTGCACAAAAA
    TTAGCTAATATTCCAGGAATTGGAGAAATTGTTGAGAAATTTAGTCGTTGGATTATGGCT
    ATTATTTATATAGCTTTAGGTTTATTTATTATTATTGAAAATGACACTATTCAAACAATT
    TTAGGATTTATATTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00020 [old locus tag: SAP005 ]
  • symbol: SA_RS00020
  • description: cadmium transporter
  • length: 205
  • theoretical pI: 8.14825
  • theoretical MW: 22818.4
  • GRAVY: 1.12878

Function[edit source | edit]

  • TIGRFAM:
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescadmium resistance transporter family protein (TIGR00779; HMM-score: 307.5)
    and 3 more
    Genetic information processingProtein fateProtein modification and repaircytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 7.8)
    MetabolismEnergy metabolismElectron transportcytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 7.8)
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 4.4)
  • TheSEED:
  • PFAM:
    LysE (CL0292) Cad; Cadmium resistance transporter (PF03596; HMM-score: 302.2)
    and 5 more
    FumRed-TM (CL0335) Sdh_cyt; Succinate dehydrogenase/Fumarate reductase transmembrane subunit (PF01127; HMM-score: 10.5)
    no clan definedVirul_fac_BrkB; Virulence factor BrkB (PF03631; HMM-score: 9.7)
    DUF5366; Family of unknown function (DUF5366) (PF17328; HMM-score: 8.9)
    ExbD; Biopolymer transport protein ExbD/TolR (PF02472; HMM-score: 7.8)
    Bestrophin; Bestrophin, RFP-TM, chloride channel (PF01062; HMM-score: 5.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.167
    • Ymax_pos: 31
    • Cmax: 0.249
    • Cmax_pos: 31
    • Smax: 0.235
    • Smax_pos: 27
    • Smean: 0.115
    • D: 0.147
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

  • GI: 446539470 NCBI
  • RefSeq: WP_000616816 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIQTVVAAAVLYIATAVDLLVILLIFFARAKTRKEYRDIYVGQYLGSIILILVSLFLAFVLNYVPEKWILGLLGLIPIYLGIKVAIYDDCEGEKRAKKELNEKGLSKLVGTVAIVTIASCGADNIGLFVPYFVTLSVTNLLLTLFVFLILIFFLVFTAQKLANIPGIGEIVEKFSRWIMAIIYIALGLFIIIENDTIQTILGFIF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00020 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]