From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00040 [old locus tag: SAP010 ]
  • pan locus tag?:
  • symbol: SA_RS00040
  • pan gene symbol?:
  • synonym:
  • product: class A beta-lactamase BlaZ

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00040 [old locus tag: SAP010 ]
  • symbol: SA_RS00040
  • product: class A beta-lactamase BlaZ
  • replicon: pN315
  • strand: -
  • coordinates: 7945..8790
  • length: 846
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_003140 (7945..8790) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    TTGAAAAAGTTAATATTTTTAATTGTAATTGCTTTAGTTTTAAGTGCATGTAATTCAAAC
    AGTTCACATGCCAAAGAGTTAAATGATTTAGAAAAAAAATATAATGCTCATATTGGTGTT
    TATGCTTTAGATACTAAAAGTGGTAAGGAAGTAAAATTTAATTCAGATAAGAGATTTGCC
    TATGCTTCGACTTCAAAAGCGATAAATAGTGCTATTTTGTTAGAACAAGTACCTTATAAT
    AAGTTAAATAAAAAAGTACATATTAACAAAGATGATATAGTTGCTTATTCTCCTATTTTA
    GAAAAATATGTAGGAAAAGATATCACTTTAAAAGAACTTATTGAGGCTTCAATGACATAT
    AGTGATAATACAGCAAACAATAAAATTATAAAAGAAATCGGTGGAATCAAAAAAGTTAAA
    CAACGTCTAAAAGAACTAGGAGATAAAGTAACAAATCCAGTTAGATATGAGATAGAATTA
    AATTACTATTCACCAAAGAGCAAAAAAGATACTTCAACGCCTGCTGCTTTCGGCAAGACT
    TTAAATAAACTTATCGCAAATGGAAAATTAAGCAAAAAAAATAAAAATTTCTTACTTGAT
    TTAATGTTTAATAATAAAAACGGAGACACTTTAATTAAAGATGGTGTTCCAAAAGACTAT
    AAGGTTGCTGATAAAAGTGGTCAAGCAATAACATATGCTTCTAGAAATGATGTTGCTTTT
    GTTTATCCTAAGGGCCAATCTGAACCTATTGTTTTAGTCATTTTTACGAATAAAGACAAT
    AAAAGTGATAAGCCAAATGATAAGTTGATAAGTGAAACCGCCAAGAGTGTAATGAAGGAA
    TTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    846

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00040 [old locus tag: SAP010 ]
  • symbol: SA_RS00040
  • description: class A beta-lactamase BlaZ
  • length: 281
  • theoretical pI: 10.1468
  • theoretical MW: 31453.1
  • GRAVY: -0.492883

Function[edit source | edit]

  • reaction:
    EC 3.5.2.6?  ExPASy
    Beta-lactamaseA beta-lactam + H2O = a substituted beta-amino acid
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    Beta-lactamase (CL0013) Beta-lactamase2; Beta-lactamase enzyme family (PF13354; HMM-score: 127)
    Beta-lactamase; Beta-lactamase (PF00144; HMM-score: 77.7)
    Peptidase_S11; D-alanyl-D-alanine carboxypeptidase (PF00768; HMM-score: 17.3)
    no clan definedFadA; Adhesion protein FadA (PF09403; HMM-score: 11.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.75
    • Extracellular Score: 0.7
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.762
    • Ymax_pos: 25
    • Cmax: 0.662
    • Cmax_pos: 25
    • Smax: 0.944
    • Smax_pos: 18
    • Smean: 0.891
    • D: 0.812
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446655939 NCBI
  • RefSeq: WP_000733285 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKLIFLIVIALVLSACNSNSSHAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKELIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKKNKNFLLDLMFNNKNGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00040 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]