Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00055 [old locus tag: SAP013 ]
  • pan locus tag?:
  • symbol: SA_RS00055
  • pan gene symbol?:
  • synonym:
  • product: transposase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00055 [old locus tag: SAP013 ]
  • symbol: SA_RS00055
  • product: transposase
  • replicon: pN315
  • strand: +
  • coordinates: 11288..11881
  • length: 594
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_003140 (11288..11881) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAAAATAGGTTATGCAAGAGTTTCAACTGGATTACAAAATTTAAATTTACAGGAGGAT
    CGATTAAATACATATGGTTGTGAAAAGATATTTAATGACCATATGAGTGGTTCAAAAAGT
    AAAAGACCTGGTTTAGATAAAGCAATTGAATTTGCGAGGTCAGGAGATACGATTGTTGTT
    TGGAGATTAGATAGATTGGGACGTAATATGGAGGATTTAATCACATTAGTTAATGAGCTT
    AACGAACGAGGTGTAAGTTTCCATAGTTTAGAAGAAAATATAACAATGGATAAATCAAGT
    TCAACTGGACAATTATTATTTCATTTATTCGCAGCATTTGCAGAATTTGAACGTAATTTA
    ATTTTAGAGCGTTCTTCAGCTGGCCGAATTGCAGCACGTGCTAGAGGCCGATATGGAGGC
    AGACCAGAAAAATTAAATCAAAAAGATTTAAACTTACTTAAGACACTTTATGATAATGGC
    ACGCCAATTAAGACAATTGCAGAACAGTGGCATGTTTCACGTACAACAATTTATCGTTAC
    CTCAATAAATTGGAGGACAAGGAAGATGAAAAACAAGGAGAAGTATCTAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    594

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00055 [old locus tag: SAP013 ]
  • symbol: SA_RS00055
  • description: transposase
  • length: 197
  • theoretical pI: 8.95113
  • theoretical MW: 22526.3
  • GRAVY: -0.667513

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 33.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19.4)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 16.4)
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 14.5)
  • TheSEED:
  • PFAM:
    no clan definedResolvase; Resolvase, N terminal domain (PF00239; HMM-score: 152.8)
    HTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 64)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 27.5)
    HTH_11; HTH domain (PF08279; HMM-score: 27)
    HTH_22; HTH domain (PF13309; HMM-score: 23.5)
    Mga; Mga helix-turn-helix domain (PF05043; HMM-score: 22.8)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 22.4)
    MarR_2; MarR family (PF12802; HMM-score: 20.5)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 20.5)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 20.1)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 19.8)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 19.7)
    MarR; MarR family (PF01047; HMM-score: 18.5)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 16.8)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 16.1)
    HTH_30; PucR C-terminal helix-turn-helix domain (PF13556; HMM-score: 15.9)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 15.7)
    Trp_repressor; Trp repressor protein (PF01371; HMM-score: 15.6)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.3)
    no clan definedTnsD; Tn7-like transposition protein D (PF15978; HMM-score: 14.6)
    HTH (CL0123) Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.7)
    HTH_32; Homeodomain-like domain (PF13565; HMM-score: 13.7)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 13.6)
    HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 13.1)
    TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 12.9)
    HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.5)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.5)
    HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 12.1)
    GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.14
    • Ymax_pos: 27
    • Cmax: 0.111
    • Cmax_pos: 27
    • Smax: 0.295
    • Smax_pos: 17
    • Smean: 0.14
    • D: 0.14
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446613292 NCBI
  • RefSeq: WP_000690638 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIGYARVSTGLQNLNLQEDRLNTYGCEKIFNDHMSGSKSKRPGLDKAIEFARSGDTIVVWRLDRLGRNMEDLITLVNELNERGVSFHSLEENITMDKSSSTGQLLFHLFAAFAEFERNLILERSSAGRIAARARGRYGGRPEKLNQKDLNLLKTLYDNGTPIKTIAEQWHVSRTTIYRYLNKLEDKEDEKQGEVSN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00055 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]