From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00065
  • pan locus tag?:
  • symbol: SA_RS00065
  • pan gene symbol?:
  • synonym:
  • product: recombinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00065
  • symbol: SA_RS00065
  • product: recombinase
  • replicon: pN315
  • strand: +
  • coordinates: 13378..14046
  • length: 669
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_003140 (13378..14046) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATATGTTATGGTCAACCTGGTGTCGGAAAAACTTTATCGTCTAGGTATTACACAAATTGG
    GATACTATTGAAAAACAAGTTAACCATAGAGGTTGGGAAGATTTAGCTAGTAAAACGACC
    GATGACATACTATCGGTGGATAAAATATTTTATACTGCACCAGCAGAAAAACAATCAGGT
    AAATCTATAGAAAACAGACCTGTTTTTCAAGAAGTATTAAATTTTTTAAGAATGGGAGAT
    CGTTTAATTGTTGAATCTATTGATAGACTAGGAAGAAATTACGAGGAAATAATTCAAACA
    GTTAATTACTTAAAAGATAAAGAAGTTCAGCTCATGATAACGAGTTTACCTATGATGAAT
    GAAGTCATTGGAAATCCACTACTAGATAAATTTATGAAAGATTTAATTATTCAAATTTTA
    GCAATGATTTCAGAACAAGAAAGAAATGAAAGTAAACGTCGACAAGCTCAAGGGATTCAA
    GTCGCCAAAGAAAAAGGTATATATAAAGGGAGACCTGTTCTGTATTCTCCCAATGCTAAA
    GACCCACAAAAGCGTTTAGTTTATTACCGAGTTGTTGAATTACTTGAACAGGGTAAATCT
    ATAAGTACTATAGCTAAAGAAGTTGGTATTACACGTCAAACTATATATAGAATAAAAAAT
    AGTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    669

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00065
  • symbol: SA_RS00065
  • description: recombinase
  • length: 222
  • theoretical pI: 9.75649
  • theoretical MW: 25667.4
  • GRAVY: -0.54009

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 16.7)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 16.7)
    probable regulatory domain (TIGR03879; HMM-score: 15.8)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 15.5)
  • TheSEED:
  • PFAM:
    no clan definedResolvase; Resolvase, N terminal domain (PF00239; HMM-score: 78.6)
    HTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 58.2)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 32.2)
    P-loop_NTPase (CL0023) AAA_22; AAA domain (PF13401; HMM-score: 28.4)
    HTH (CL0123) CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 28.2)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 25)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 24.3)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 24.2)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 19.6)
    DUF433; Protein of unknown function (DUF433) (PF04255; HMM-score: 19)
    no clan definedDUF2802; Protein of unknown function (DUF2802) (PF10975; HMM-score: 18.7)
    HTH (CL0123) HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 18.5)
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 17.7)
    HTH_11; HTH domain (PF08279; HMM-score: 15.8)
    HTH_22; HTH domain (PF13309; HMM-score: 14.3)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 14.2)
    Trp_repressor; Trp repressor protein (PF01371; HMM-score: 14)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 14)
    HTH_Tnp_1; Transposase (PF01527; HMM-score: 13.8)
    P-loop_NTPase (CL0023) RuvB_N; Holliday junction DNA helicase ruvB N-terminus (PF05496; HMM-score: 13.7)
    HTH (CL0123) Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 13.4)
    TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 13.1)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.6)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 12.6)
    no clan definedTnsD; Tn7-like transposition protein D (PF15978; HMM-score: 12.3)
    DUF3572; Protein of unknown function (DUF3572) (PF12096; HMM-score: 12.1)
    HTH (CL0123) Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 11
    • Cmax: 0.114
    • Cmax_pos: 26
    • Smax: 0.195
    • Smax_pos: 1
    • Smean: 0.119
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_078061227 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MCYGQPGVGKTLSSRYYTNWDTIEKQVNHRGWEDLASKTTDDILSVDKIFYTAPAEKQSGKSIENRPVFQEVLNFLRMGDRLIVESIDRLGRNYEEIIQTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMISEQERNESKRRQAQGIQVAKEKGIYKGRPVLYSPNAKDPQKRLVYYRVVELLEQGKSISTIAKEVGITRQTIYRIKNSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00065 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]