Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00110
  • pan locus tag?:
  • symbol: SA_RS00110
  • pan gene symbol?:
  • synonym:
  • product: recombinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00110
  • symbol: SA_RS00110
  • product: recombinase
  • replicon: pN315
  • strand: +
  • coordinates: 20313..20639
  • length: 327
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_003140 (20313..20639) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    TTGGAAGAAGAATACGGTAAAGAAAATCTTTTATATGCGACAGTACATATGGATGAGATA
    ACACCACATATGCATTATGGCGTAATTCCTATTACTAAAGATGGACGTTTAAGTGCGAAA
    GAAGTTGTAGGTAATAAAAAAGCATTAACCGAATTCCAAGATAGATTCAATACGTATATT
    AATAAGCAAGGCTATGATTTAAAACGAGGAATTTCTAGACAACTTACAAAAGAAAAACAT
    GATCAAGTTAGCGGCTATAAACAAAAAACAGAATATCATAAACAAATGTATATGCGCGAG
    AAGCAAATAGAGGATCATTTAAAGTGA
    60
    120
    180
    240
    300
    327

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00110
  • symbol: SA_RS00110
  • description: recombinase
  • length: 108
  • theoretical pI: 9.19086
  • theoretical MW: 12878.6
  • GRAVY: -1.13796

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsergothioneine biosynthesis protein EgtB (TIGR03440; HMM-score: 13.2)
  • TheSEED:
  • PFAM:
    Rep (CL0169) Mob_Pre; Plasmid recombination enzyme (PF01076; HMM-score: 112.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.105
    • Ymax_pos: 49
    • Cmax: 0.109
    • Cmax_pos: 40
    • Smax: 0.122
    • Smax_pos: 44
    • Smean: 0.075
    • D: 0.093
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001582045 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MEEEYGKENLLYATVHMDEITPHMHYGVIPITKDGRLSAKEVVGNKKALTEFQDRFNTYINKQGYDLKRGISRQLTKEKHDQVSGYKQKTEYHKQMYMREKQIEDHLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00110 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]