From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00520 [old locus tag: SA0076 ]
  • pan locus tag?: SAUPAN000741000
  • symbol: SA_RS00520
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00520 [old locus tag: SA0076 ]
  • symbol: SA_RS00520
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 84844..85470
  • length: 627
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (84844..85470) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGCAATTACAAACCATGAGTAATTCCATATTTATAAAAAATTTGATTTTTGCAATAAAT
    GAATCGTTAGAATATTCTGAAACCAACTCTGTCATGGAAGTTACTTTTCAAAAGGCTATA
    GGCTTCACTCAATACAATTTTGAAGGAGAAAAATTAAAATTAAAGGATGACTTGAAGGAG
    TTAATAAGCCTTGTTGGACGAGAAGAAGCTGTATTGATATTCGTAAACCGATTGAATGAA
    GGTCTATATTGTATTTTAAATCAACTAATAGAATGGGATAATCTAAATTATCAATTCGCC
    ATGTATAAAGAGGCTATGCATAATTACTTATTTAATACAATTGAGAAATTAAATGATGAC
    ACACTTTTCCTCCTGCATCAAGATGGTTTAATTACATTGCCTGAGCATAAGTACAAAACT
    GTAGCCGTAAAAAGTACATTCGGTAGTAGAGATTTTACTTTTAGATTTAAATTTCCAGAA
    GAATCAGATACAGTTAATACACACCAAATGCTAAATAAAGCAATATCAATTACAGGTAGT
    CTAGCAAATACACATTTGGAACAACCCCAAAAATACAAGGCACATTTTAAAAAAATACCA
    ATCGAAACAAAAAATTTGACATCTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00520 [old locus tag: SA0076 ]
  • symbol: SA_RS00520
  • description: hypothetical protein
  • length: 208
  • theoretical pI: 6.24802
  • theoretical MW: 24237.6
  • GRAVY: -0.317308

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.161
    • Ymax_pos: 19
    • Cmax: 0.13
    • Cmax_pos: 19
    • Smax: 0.337
    • Smax_pos: 2
    • Smean: 0.219
    • D: 0.184
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447099713 NCBI
  • RefSeq: WP_001176969 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MQLQTMSNSIFIKNLIFAINESLEYSETNSVMEVTFQKAIGFTQYNFEGEKLKLKDDLKELISLVGREEAVLIFVNRLNEGLYCILNQLIEWDNLNYQFAMYKEAMHNYLFNTIEKLNDDTLFLLHQDGLITLPEHKYKTVAVKSTFGSRDFTFRFKFPEESDTVNTHQMLNKAISITGSLANTHLEQPQKYKAHFKKIPIETKNLTS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00520 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]