From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02615 [old locus tag: SA0454 ]
  • pan locus tag?: SAUPAN002234000
  • symbol: SA_RS02615
  • pan gene symbol?: purR
  • synonym:
  • product: pur operon repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS02615 [old locus tag: SA0454 ]
  • symbol: SA_RS02615
  • product: pur operon repressor
  • replicon: chromosome
  • strand: +
  • coordinates: 525107..525931
  • length: 825
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (525107..525931) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAGATATAAACGAAGCGAGAGAATTGTTTTTATGACGCAATATTTGATGAACCATCCG
    AATAAATTGATTCCATTAACTTTTTTTGTGAAAAAATTTAAACAGGCGAAATCTTCAATA
    AGTGAAGATGTCCAAATTATAAAAAATACATTCCAAAAAGAAAAGTTAGGTACAGTAATT
    ACTACTGCTGGCGCAAGTGGTGGTGTTACGTATAAACCAATGATGAGTAAAGAAGAGGCG
    ACTGAAGTTGTTAATGAGGTCATTACTCTATTAGAAGAGAAAGAACGTTTGTTACCTGGC
    GGGTATTTATTTTTATCAGATTTGGTAGGTAATCCATCGCTACTAAACAAAGTTGGTAAG
    TTAATTGCCAGTATTTACATGGAAGAAAAATTAGATGCTGTTGTTACCATTGCGACAAAA
    GGTATTTCATTGGCAAATGCGGTTGCTAATATTTTAAATTTACCAGTAGTAGTGATTAGA
    AAAGACAACAAGGTGACTGAAGGTTCTACAGTTTCAATTAATTACGTTTCAGGATCTTCA
    AGAAAAATAGAGACAATGGTACTTTCGAAGAGAACTTTAGCAGAAAATTCAAATGTTTTA
    GTTGTCGATGATTTTATGAGGGCTGGTGGCTCTATTAATGGTGTTATGAATTTAATGAAT
    GAGTTTAAAGCCCATGTAAAAGGGGTATCAGTACTTGTAGAATCAAAAGAAGTTAAACAA
    AGATTGATTGAAGATTATACTTCCTTAGTGAAATTATCTGATGTAGATGAATATAATCAA
    GAGTTTAACGTAGAACCTGGCAACAGTTTATCTAAGTTTTCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    825

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS02615 [old locus tag: SA0454 ]
  • symbol: SA_RS02615
  • description: pur operon repressor
  • length: 274
  • theoretical pI: 9.54206
  • theoretical MW: 30395.1
  • GRAVY: -0.0715328

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesispur operon repressor PurR (TIGR01743; HMM-score: 361.7)
    Signal transductionRegulatory functionsDNA interactionspur operon repressor PurR (TIGR01743; HMM-score: 361.7)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesxanthine phosphoribosyltransferase (TIGR01744; EC 2.4.2.22; HMM-score: 67)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 65.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 43.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 30.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 20)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotideshypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 18.1)
  • TheSEED:
  • PFAM:
    HTH (CL0123) PuR_N; Bacterial purine repressor, N-terminal (PF09182; HMM-score: 107.4)
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 76.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS11130(deoA)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    SA_RS09855(gatA)glutamyl-tRNA(Gln) amidotransferase subunit A  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS02145IMP dehydrogenase  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS04710hypothetical protein  [1] (data from MRSA252)
    SA_RS04915enoyl-ACP reductase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS05945carbamoyl-phosphate synthase large chain  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06235elongation factor Ts  [1] (data from MRSA252)
    SA_RS07385DNA-binding protein HU  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS08625universal stress protein UspA  [1] (data from MRSA252)
    SA_RS09850aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B  [1] (data from MRSA252)
    SA_RS1173050S ribosomal protein L16  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.17
    • Ymax_pos: 12
    • Cmax: 0.126
    • Cmax_pos: 66
    • Smax: 0.43
    • Smax_pos: 1
    • Smean: 0.271
    • D: 0.209
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447192387 NCBI
  • RefSeq: WP_001269643 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRYKRSERIVFMTQYLMNHPNKLIPLTFFVKKFKQAKSSISEDVQIIKNTFQKEKLGTVITTAGASGGVTYKPMMSKEEATEVVNEVITLLEEKERLLPGGYLFLSDLVGNPSLLNKVGKLIASIYMEEKLDAVVTIATKGISLANAVANILNLPVVVIRKDNKVTEGSTVSINYVSGSSRKIETMVLSKRTLAENSNVLVVDDFMRAGGSINGVMNLMNEFKAHVKGVSVLVESKEVKQRLIEDYTSLVKLSDVDEYNQEFNVEPGNSLSKFS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS02615 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]