Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000123 [new locus tag: EGJ38_RS00620 ]
- pan locus tag?: SAUPAN001020000
- symbol: EGJ38_000123
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000123
- product: YagU family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000123 [new locus tag: EGJ38_RS00620 ]
- symbol: EGJ38_000123
- product: YagU family protein
- replicon: chromosome
- strand: -
- coordinates: 146766..147245
- length: 480
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422131 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGGTATATTCATTTATGCTGGAATTATCGGTGGCTTGTTATCTGGAATTGTAAAATTA
GGTTGGGAGGTCATGTTTCCACCTCGCACACCAGAACGTAATGCAACGAACCCACCTCAA
GAGTTATTGCAACAATTAGGATTTAGTAGTGAGTTTACGCATCAAACATATACATTTTCA
AATATGGAATTGCCTTGGGTAAGCTTTATTGTCCACTTTAGTTTTTCTATCGTCATTGCA
ATTATTTACTGCATATTAGTTAAAAAATACGCTTACTTAGCAATGGGACAAGGTGCTGTT
TTTGGTATTGCTATTTGGGTATTATTCCACCTTATCATTATGCCAATCATGCATACTGTA
CCTGCTGTGTGGGATCAACCATTCCAAGAGCATCTGTCAGAATTCTTTGGCCATATCGTC
TGGATGATGACAATTGAATTAGTGCGACAACATTTTGTCTATCGCTATAAATTAAATTAA60
120
180
240
300
360
420
480
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000123 [new locus tag: EGJ38_RS00620 ]
- symbol: EGJ38_000123
- description: YagU family protein
- length: 159
- theoretical pI: 7.23127
- theoretical MW: 18415.7
- GRAVY: 0.546541
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DUF1440; Protein of unknown function (DUF1440) (PF07274; HMM-score: 213.8)and 3 moreYqhR; Conserved membrane protein YqhR (PF11085; HMM-score: 17.2)DUF1761; Protein of unknown function (DUF1761) (PF08570; HMM-score: 16.9)DUF6789; Family of unknown function (DUF6789) (PF20587; HMM-score: 10.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0012
- Cytoplasmic Membrane Score: 0.9983
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.169662
- TAT(Tat/SPI): 0.006864
- LIPO(Sec/SPII): 0.048968
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422131 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQELLQQLGFSSEFTHQTYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAMGQGAVFGIAIWVLFHLIIMPIMHTVPAVWDQPFQEHLSEFFGHIVWMMTIELVRQHFVYRYKLN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: ArcR (activation) regulon, GraR (repression) regulon, Rex (repression) regulon
ArcR (TF) important in Arginine degradation; regulation predicted or transferred from N315 and NCTC 8325 [1] GraR (response regulator) important in cationic antimicrobial peptide (CAMP) resistance; regulation predicted or transferred from N315 and NCTC 8325 [2] Rex (TF) important in Energy metabolism; regulation predicted or transferred from N315 and NCTC 8325 [1]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e) - ↑ Mélanie Falord, Ulrike Mäder, Aurélia Hiron, Michel Débarbouillé, Tarek Msadek
Investigation of the Staphylococcus aureus GraSR regulon reveals novel links to virulence, stress response and cell wall signal transduction pathways.
PLoS One: 2011, 6(7);e21323
[PubMed:21765893] [WorldCat.org] [DOI] (I p)