From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000493 [new locus tag: EGJ38_RS02460 ]
  • pan locus tag?: SAUPAN002304000
  • symbol: secE
  • pan gene symbol?: secE
  • synonym:
  • alternate name: JSNZ_000493
  • product: preprotein translocase subunit SecE

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000493 [new locus tag: EGJ38_RS02460 ]
  • symbol: secE
  • product: preprotein translocase subunit SecE
  • replicon: chromosome
  • strand: +
  • coordinates: 523216..523398
  • length: 183
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422473 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCTAAAAAAGAAAGTTTCTTTAAAGGCGTTAAGTCTGAAATGGAAAAAACAAGTTGG
    CCGACGAAAGAAGAGCTATTTAAATATACTGTAATTGTAGTTTCTACTGTTATATTCTTC
    TTAGTCTTTTTCTATGCCTTAGATTTAGGAATTACAGCATTGAAAAATTTATTATTTGGT
    TAG
    60
    120
    180
    183


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000493 [new locus tag: EGJ38_RS02460 ]
  • symbol: SecE
  • description: preprotein translocase subunit SecE
  • length: 60
  • theoretical pI: 9.66311
  • theoretical MW: 6932.22
  • GRAVY: 0.47

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecE subunit (TIGR00964; HMM-score: 76.9)
    and 1 more
    HAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 12)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 70)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9979
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0021
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004468
    • TAT(Tat/SPI): 0.000132
    • LIPO(Sec/SPII): 0.001904
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422473 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]