Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000499 [new locus tag: EGJ38_RS02490 ]
- pan locus tag?: SAUPAN002312000
- symbol: rsmC
- pan gene symbol?: rsmC
- synonym:
- alternate name: JSNZ_000499
- product: class I SAM-dependent methyltransferase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000499 [new locus tag: EGJ38_RS02490 ]
- symbol: rsmC
- product: class I SAM-dependent methyltransferase
- replicon: chromosome
- strand: +
- coordinates: 526820..527428
- length: 609
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422479 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAGTCATTATTACGATGAAGATCCAAGTGTAATTAGCAATGAACAACGTATTCAATAT
CAATTAAACCATCATAAAATTGATTTAATAACTGATAACGGAGTGTTTTCGAAAGATAAA
GTAGATTATGGTTCAGATGTTCTTGTTCAAACTTTTTTAAAAGCGCATTCACCTGGTCCA
AGTAAGCGAATTGCCGATGTTGGTTGTGGTTACGGACCAATTGGTTTGATGATTGCTAAA
GTATCACCACATCATTCAATTACAATGCTAGATGTTAATCACAGAGCGCTAGCCTTAGTT
GAAAAAAACAAAAAATTAAATGGTATTGATAATGTGATCGTAAAAGAAAGTGATGCTTTG
TCTGCTGTGGAAGACAAAAGTTTTGATTTTATTTTAACCAATCCACCAATAAGAGCAGGG
AAAGAAACCGTGCATCGTATATTCGAGCAAGCATTACATAGATTAGACTCGAACGGTGAA
CTATTCGTTGTAATTCAGAAGAAGCAAGGTATGCCATCTGCAAAGAAAAGAATGAATGAA
CTTTTTGGAAATGTAGAAGTGGTAAATAAAGATAAAGGATATTACATTCTGAGAAGTATA
AAAGCTTGA60
120
180
240
300
360
420
480
540
600
609
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000499 [new locus tag: EGJ38_RS02490 ]
- symbol: RsmC
- description: class I SAM-dependent methyltransferase
- length: 202
- theoretical pI: 8.90035
- theoretical MW: 22669.8
- GRAVY: -0.374752
⊟Function[edit | edit source]
- reaction: EC 2.1.1.172? ExPASy16S rRNA (guanine1207-N2)-methyltransferase S-adenosyl-L-methionine + guanine1207 in 16S rRNA = S-adenosyl-L-homocysteine + N2-methylguanine1207 in 16S rRNAEC 2.1.1.174? ExPASy23S rRNA (guanine1835-N2)-methyltransferase S-adenosyl-L-methionine + guanine1835 in 23S rRNA = S-adenosyl-L-homocysteine + N2-methylguanine1835 in 23S rRNA
- TIGRFAM: Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 70.9)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 60.7)and 24 moreProtein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 54.1)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 39.3)Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 29.7)Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 29.1)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 27)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 26.9)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 23.2)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 22.9)Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 22.3)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumB (TIGR02085; EC 2.1.1.189; HMM-score: 21.4)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 21.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides putative sugar O-methyltransferase (TIGR04371; EC 2.1.1.-; HMM-score: 19.5)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 18.1)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 16.9)Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 16.6)Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 16.3)Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 15.9)Protein synthesis tRNA and rRNA base modification 16S rRNA (cytosine(967)-C(5))-methyltransferase (TIGR00563; EC 2.1.1.176; HMM-score: 14.1)Protein synthesis tRNA and rRNA base modification N2,N2-dimethylguanosine tRNA methyltransferase (TIGR00308; EC 2.1.1.-; HMM-score: 13.9)methyltransferase, FkbM family (TIGR01444; HMM-score: 13.2)Transcription RNA processing 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 12.2)Protein synthesis tRNA and rRNA base modification 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 12.2)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll C-20 methyltransferase BchU (TIGR02716; EC 2.1.1.-; HMM-score: 12.1)Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 12.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: NADP_Rossmann (CL0063) MTS; Methyltransferase small domain (PF05175; HMM-score: 179.6)and 22 moreMethyltransf_31; Methyltransferase domain (PF13847; HMM-score: 48)Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 38.1)GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 29.2)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 28.7)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 28.1)PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 24.9)Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 24.6)TRM5-TYW2_MTfase; TRM5/TYW2 methyltransferase domain (PF02475; HMM-score: 23.1)Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 22.1)Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 21.1)TehB; Tellurite resistance protein TehB (PF03848; HMM-score: 20.7)Methyltransf_16; Lysine methyltransferase (PF10294; HMM-score: 20.4)TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 19.4)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 19.3)UPF0020; RMKL-like, methyltransferase domain (PF01170; HMM-score: 19.2)Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 18.8)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 18.6)Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 17.8)no clan defined MTS_N; Methyltransferase small domain N-terminal (PF08468; HMM-score: 17.5)NADP_Rossmann (CL0063) Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.9)Eco57I; Eco57I restriction-modification methylase (PF07669; HMM-score: 12.7)Methyltransf_2; O-methyltransferase domain (PF00891; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9963
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0024
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009576
- TAT(Tat/SPI): 0.000609
- LIPO(Sec/SPII): 0.001081
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422479 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGSDVLVQTFLKAHSPGPSKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNKKLNGIDNVIVKESDALSAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFVVIQKKQGMPSAKKRMNELFGNVEVVNKDKGYYILRSIKA
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)