Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000502 [new locus tag: EGJ38_RS02505 ]
- pan locus tag?: SAUPAN002316000
- symbol: rplGB
- pan gene symbol?: rplGB
- synonym: JSNZ_000502
- product: ribosomal L7Ae/L30e/S12e/Gadd45 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000502 [new locus tag: EGJ38_RS02505 ]
- symbol: rplGB
- product: ribosomal L7Ae/L30e/S12e/Gadd45 family protein
- replicon: chromosome
- strand: +
- coordinates: 535091..535345
- length: 255
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422482 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGTCTAAGGAAAAAGTTGCACGCTTTAACAAACAACATTTTGTAGTTGGTCTTAAAGAA
ACGCTTAAAGCGTTAAAGAAAGATCAAGTTACATCTTTGATTATTGCTGAAGACGTTGAA
GTATATTTAATGACTCGCGTGTTAAGCCAAATCAATCAGAAAAATATACCTGTATCTTTT
TTCAAAAGCAAACATGCTTTGGGTAAACATGTAGGTATTAACGTCAATGCGACAATAGTA
GCATTGATTAAATGA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000502 [new locus tag: EGJ38_RS02505 ]
- symbol: RplGB
- description: ribosomal L7Ae/L30e/S12e/Gadd45 family protein
- length: 84
- theoretical pI: 10.8182
- theoretical MW: 9446.19
- GRAVY: 0.0607143
⊟Function[edit | edit source]
- TIGRFAM: ribosomal protein eL8 (TIGR03677; HMM-score: 37.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 39.2)and 4 moreeRF1_3; eRF1 domain 3 (PF03465; HMM-score: 17.4)no clan defined DUF1694; Protein of unknown function (DUF1694) (PF07997; HMM-score: 14.8)HAD_Pex22; Peroxisome biogenesis protein 22, Haloacid dehydrogenase-like domain (PF22978; HMM-score: 14.3)Cas_Cas1; CRISPR associated protein Cas1 (PF01867; HMM-score: 14.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9925
- Cytoplasmic Membrane Score: 0.0019
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0056
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001767
- TAT(Tat/SPI): 0.000214
- LIPO(Sec/SPII): 0.00029
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422482 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)