Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000503 [new locus tag: EGJ38_RS02510 ]
- pan locus tag?: SAUPAN002317000
- symbol: rpsL
- pan gene symbol?: rpsL
- synonym:
- alternate name: JSNZ_000503
- product: 30S ribosomal protein S12
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000503 [new locus tag: EGJ38_RS02510 ]
- symbol: rpsL
- product: 30S ribosomal protein S12
- replicon: chromosome
- strand: +
- coordinates: 535444..535857
- length: 414
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422483 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCCAACTATTAACCAATTAGTACGTAAACCAAGACAAAGCAAAATCAAAAAATCAGAT
TCTCCAGCTTTAAATAAAGGTTTCAACAGTAAAAAGAAAAAATTTACTGATTTAAACTCA
CCACAAAAACGTGGTGTATGTACTCGTGTAGGTACAATGACACCTAAAAAACCTAACTCA
GCGTTACGTAAATATGCACGTGTGCGTTTATCAAACAACATCGAAATTAACGCATACATC
CCTGGTATCGGACATAACTTACAAGAACACAGTGTTGTACTTGTACGTGGTGGACGTGTA
AAAGACTTACCAGGTGTGCGTTACCATATTGTACGTGGAGCACTTGATACTTCAGGTGTT
GACGGACGTAGACAAGGTCGTTCATTATACGGAACTAAGAAACCTAAAAACTAA60
120
180
240
300
360
414
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000503 [new locus tag: EGJ38_RS02510 ]
- symbol: RpsL
- description: 30S ribosomal protein S12
- length: 137
- theoretical pI: 11.8375
- theoretical MW: 15286.7
- GRAVY: -0.854015
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00981; HMM-score: 221.2)and 2 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00982; HMM-score: 39.4)Protein synthesis Translation factors translation initiation factor IF-1 (TIGR00008; HMM-score: 13.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: OB (CL0021) Ribosom_S12_S23; Ribosomal protein S12/S23 (PF00164; HMM-score: 119.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6412
- Cytoplasmic Membrane Score: 0.0508
- Cell wall & surface Score: 0.0014
- Extracellular Score: 0.3066
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029192
- TAT(Tat/SPI): 0.011807
- LIPO(Sec/SPII): 0.005124
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422483 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)