Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0591 [new locus tag: SACOL_RS03065 ]
- pan locus tag?: SAUPAN002317000
- symbol: rpsL
- pan gene symbol?: rpsL
- synonym:
- product: 30S ribosomal protein S12
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0591 [new locus tag: SACOL_RS03065 ]
- symbol: rpsL
- product: 30S ribosomal protein S12
- replicon: chromosome
- strand: +
- coordinates: 614788..615201
- length: 414
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236181 NCBI
- RefSeq: YP_185477 NCBI
- BioCyc:
- MicrobesOnline: 912071 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCCAACTATTAACCAATTAGTACGTAAACCAAGACAAAGCAAAATCAAAAAATCAGAT
TCTCCAGCTTTAAATAAAGGTTTCAACAGTAAAAAGAAAAAATTTACTGACTTAAACTCA
CCACAAAAACGTGGTGTATGTACTCGTGTAGGTACAATGACACCTAGAAAACCTAACTCA
GCGTTACGTAAATATGCACGTGTGCGTTTATCAAACAACATCGAAATTAACGCATACATC
CCTGGTATCGGACATAACTTACAAGAACACAGTGTTGTACTTGTACGTGGTGGACGTGTA
AGAGACTTACCAGGTGTGCGTTACCATATTGTACGTGGAGCACTTGATACTTCAGGTGTT
GACGGACGTAGACAAGGTCGTTCATTATACGGAACTAAGAAACCTAAAAACTAA60
120
180
240
300
360
414
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0591 [new locus tag: SACOL_RS03065 ]
- symbol: RpsL
- description: 30S ribosomal protein S12
- length: 137
- theoretical pI: 12.011
- theoretical MW: 15342.7
- GRAVY: -0.862774
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00981; HMM-score: 218.8)and 2 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00982; HMM-score: 39.2)Protein synthesis Translation factors translation initiation factor IF-1 (TIGR00008; HMM-score: 12.6)
- TheSEED: and 3 more
- PFAM: OB (CL0021) Ribosom_S12_S23; Ribosomal protein S12/S23 (PF00164; HMM-score: 119.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SACOL1760 (ackA) acetate kinase [1] (data from MRSA252) SACOL1247 (acpP) acyl carrier protein [1] (data from MRSA252) SACOL2657 (arcA) arginine deiminase [1] (data from MRSA252) SACOL0833 (clpP) ATP-dependent Clp protease proteolytic subunit [1] (data from MRSA252) SACOL1272 (codY) transcriptional repressor CodY [1] (data from MRSA252) SACOL2130 (deoD) purine nucleoside phosphorylase [1] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SACOL1329 (femC) glutamine synthetase [1] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SACOL2016 (groEL) chaperonin GroEL [1] (data from MRSA252) SACOL1206 (ileS) isoleucyl-tRNA synthetase [1] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SACOL1368 (kataA) catalase [1] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SACOL1005 (pepF) oligoendopeptidase F [1] (data from MRSA252) SACOL0966 (pgi) glucose-6-phosphate isomerase [1] (data from MRSA252) SACOL1982 (ppaC) manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) SACOL1091 (ptsH) phosphocarrier protein HPr [1] (data from MRSA252) SACOL1689 (relA2) GTP pyrophosphokinase [1] (data from MRSA252) SACOL1536 (rluB) ribosomal large subunit pseudouridine synthase B [1] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SACOL0015 (rplI) 50S ribosomal protein L9 [1] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL2229 (rplN) 50S ribosomal protein L14 [1] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SACOL0545 (rplY) 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SACOL1700 (rpmA) 50S ribosomal protein L27 [1] (data from MRSA252) SACOL1238 (rpmB) 50S ribosomal protein L28 [1] (data from MRSA252) SACOL2231 (rpmC) 50S ribosomal protein L29 [1] (data from MRSA252) SACOL1516 (rpsA) 30S ribosomal protein S1 [1] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [1] (data from MRSA252) SACOL1292 (rpsO) 30S ribosomal protein S15 [1] (data from MRSA252) SACOL1254 (rpsP) 30S ribosomal protein S16 [1] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SACOL0439 (rpsR) 30S ribosomal protein S18 [1] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SACOL1642 (rpsT) 30S ribosomal protein S20 [1] (data from MRSA252) SACOL0095 (spa) immunoglobulin G binding protein A precursor [1] (data from MRSA252) SACOL1449 (sucA) 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SACOL0840 (tpiA) triosephosphate isomerase [1] (data from MRSA252) SACOL1762 (tpx) thiol peroxidase [1] (data from MRSA252) SACOL0303 5'-nucleotidase [1] (data from MRSA252) SACOL0552 hypothetical protein [1] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [1] (data from MRSA252) SACOL0742 hypothetical protein [1] (data from MRSA252) SACOL1020 hypothetical protein [1] (data from MRSA252) SACOL1098 hypothetical protein [1] (data from MRSA252) SACOL1294 metallo-beta-lactamase [1] (data from MRSA252) SACOL1593 glycine dehydrogenase subunit 2 [1] (data from MRSA252) SACOL1651 hypothetical protein [1] (data from MRSA252) SACOL1670 hypothetical protein [1] (data from MRSA252) SACOL1753 universal stress protein [1] (data from MRSA252) SACOL2131 Dps family protein [1] (data from MRSA252) SACOL2173 alkaline shock protein 23 [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.026283
- TAT(Tat/SPI): 0.013391
- LIPO(Sec/SPII): 0.00523
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVRDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlasquantitative data / protein copy number per cell: 4262 [5]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 8.87 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑
Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑
Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑
Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑
Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑
Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]