From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000600 [new locus tag: EGJ38_RS02995 ]
  • pan locus tag?: SAUPAN002509000
  • symbol: mntA
  • pan gene symbol?: mntA
  • synonym:
  • alternate name: JSNZ_000600
  • product: metal ABC transporter ATP-binding protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000600 [new locus tag: EGJ38_RS02995 ]
  • symbol: mntA
  • product: metal ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 635100..635843
  • length: 744
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422578 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    TTGTTAGAAACAAAAGATTTAAATCTGTTTTTAGGTAATAAGCATGTACTTAAAAACATT
    TCCTTATCGATACCAGTACGCGGCGAAATAATTGGTATCATGGGCCCGAATGGTGCTGGT
    AAATCTTCCCTTATCAAGTCTTTAATTGGTGAATTTAATGCTACCGGTACTAAATTGTTA
    TATAACAAACCTATACAACAACAACTGCAACATATTACATATATTCCACAAAAAGCACAT
    ATTGATTTAGATTTTCCTATAAGTGTGGAACAAGTGATTTTATCAGGTTGCTACAAAGAA
    ATTGGATGGTTTAGACGACCTAATAAATCAGCAAGGGATAAACTCAAACAGTTATTAAGC
    GATTTAGAATTAGAATCTTTACGTCATCGACAAATTTCAGAATTAAGTGGTGGACAATTA
    CAACGTGTGCTAGTAGCAAGAGCATTGATGTCCGAAAGTGAAGTTTATTTTCTAGATGAG
    CCGTTTGTCGGAATTGATTTTAGTAGCGAAAAATTAATCATGACAAAAATCGAGAACTTA
    AAACAACAAGGAAAACTTATTCTTATCATCCACCATGATCTATCAAAAGCAAAGCAATAC
    TTTGATCGCATTATTCTATTAAATCAAACATTACGATACTTTGGTGATAGTGAAGAGGCT
    ATGAGTGTCACTCGCTTAAACGAAACATTTATGAGTAGCACTGACTGTAGTGACCCTAGT
    CAAAGGAGCAATATAACATGTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    744


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000600 [new locus tag: EGJ38_RS02995 ]
  • symbol: MntA
  • description: metal ABC transporter ATP-binding protein
  • length: 247
  • theoretical pI: 8.45919
  • theoretical MW: 28024.2
  • GRAVY: -0.217004

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 174)
    and 80 more
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 110.4)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 106.5)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 98.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 97.1)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 97.1)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 96.1)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 95.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 94.6)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 94.4)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 94.4)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 90.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 86.9)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 86.9)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 86.8)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 86.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 83.1)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 83.1)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 83.1)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 82.9)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 81.4)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 77.2)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 76.8)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 76.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 74.6)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 74.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 74)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 73.5)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 73.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 73.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 72.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 72.2)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 71.7)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 71.1)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 71)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 70.1)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 70.1)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 70.1)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 70)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 67.9)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 67)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 65.3)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 63.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 63.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62.4)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62.4)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 62.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 60.8)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 60.1)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 59.5)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 59.5)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 59.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 59.2)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 59.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 58.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 57.4)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 56.9)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 56.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 56.9)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 56.1)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 55.4)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 53.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 53.6)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 47.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 45.4)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 45.4)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 40.8)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 40.4)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 39.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38.9)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 32.6)
    Cellular processes Cellular processes Pathogenesis type II secretion system protein E (TIGR02533; HMM-score: 18.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein E (TIGR02533; HMM-score: 18.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.1)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 15.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 14.8)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.1)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 11.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 94.6)
    and 26 more
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 27.2)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 23.4)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 21.6)
    AAA_22; AAA domain (PF13401; HMM-score: 20.1)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17.8)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 17.3)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.2)
    KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 15.7)
    bpMoxR; MoxR domain in the MoxR-vWA-beta-propeller ternary systems (PF20030; HMM-score: 15.4)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 15)
    nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 15)
    AAA_23; AAA domain (PF13476; HMM-score: 14.9)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 14.6)
    AAA_14; AAA domain (PF13173; HMM-score: 14.3)
    MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 14.2)
    MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 13.9)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 13.9)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 13.8)
    DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 13.5)
    no clan defined Glyco_trans_A_1; Glycosyl transferase 1 domain A (PF09318; HMM-score: 13.3)
    P-loop_NTPase (CL0023) NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 12.9)
    ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.5)
    AAA_26; AAA domain (PF13500; HMM-score: 12.5)
    AAA_PrkA; PrkA AAA domain (PF08298; HMM-score: 12.1)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.3546
    • Cytoplasmic Membrane Score: 0.6302
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0151
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011745
    • TAT(Tat/SPI): 0.001085
    • LIPO(Sec/SPII): 0.000968
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422578 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLLYNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLSDLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENLKQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPSQRSNITC

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: MntR (repression) regulon
    MntR(TF)important in Manganese homeostasis;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]