Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000635 [new locus tag: EGJ38_RS03170 ]
- pan locus tag?: SAUPAN002548000
- symbol: sarX
- pan gene symbol?: sarX
- synonym:
- alternate name: JSNZ_000635
- product: HTH-type transcriptional regulator SarX
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000635 [new locus tag: EGJ38_RS03170 ]
- symbol: sarX
- product: HTH-type transcriptional regulator SarX
- replicon: chromosome
- strand: +
- coordinates: 673087..673446
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422612 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGAATACTGAGAAATTAGAAACATTGCTTGGCTTCTATAAACAATATAAAGCATTATCT
GAATATATTGATAAAAAATATAAGTTGTCGCTAAATGATTTAGCAGTCTTAGATTTAACG
ATGAAGCATTGCAAAGATGAAAAAGTACTTATGCAATCATTTTTAAAAACTGCAATGGAT
GAGCTAGATTTAAGTAGGACAAAATTATTAGTTTCTATAAGAAGACTAATTGAAAAAGAA
AGACTTAGTAAAGTTAGATCATCTAAAGATGAGCGTAAAATTTATATTTATTTAAATAAT
GATGATATATCTAAATTTAATGCTTTATTTGAAGATGTAGAACAATTTTTAAATATTTAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000635 [new locus tag: EGJ38_RS03170 ]
- symbol: SarX
- description: HTH-type transcriptional regulator SarX
- length: 119
- theoretical pI: 8.92951
- theoretical MW: 14178.4
- GRAVY: -0.447059
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 108.8)and 1 moreProtein synthesis tRNA aminoacylation histidine--tRNA ligase (TIGR00442; EC 6.1.1.21; HMM-score: 11.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 78.6)and 2 moreHTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 13.4)Linker_histone; linker histone H1 and H5 family (PF00538; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8749
- Cytoplasmic Membrane Score: 0.0259
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0985
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00281
- TAT(Tat/SPI): 0.000277
- LIPO(Sec/SPII): 0.000366
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422612 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]