From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000635 [new locus tag: EGJ38_RS03170 ]
  • pan locus tag?: SAUPAN002548000
  • symbol: sarX
  • pan gene symbol?: sarX
  • synonym:
  • alternate name: JSNZ_000635
  • product: HTH-type transcriptional regulator SarX

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000635 [new locus tag: EGJ38_RS03170 ]
  • symbol: sarX
  • product: HTH-type transcriptional regulator SarX
  • replicon: chromosome
  • strand: +
  • coordinates: 673087..673446
  • length: 360
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422612 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    TTGAATACTGAGAAATTAGAAACATTGCTTGGCTTCTATAAACAATATAAAGCATTATCT
    GAATATATTGATAAAAAATATAAGTTGTCGCTAAATGATTTAGCAGTCTTAGATTTAACG
    ATGAAGCATTGCAAAGATGAAAAAGTACTTATGCAATCATTTTTAAAAACTGCAATGGAT
    GAGCTAGATTTAAGTAGGACAAAATTATTAGTTTCTATAAGAAGACTAATTGAAAAAGAA
    AGACTTAGTAAAGTTAGATCATCTAAAGATGAGCGTAAAATTTATATTTATTTAAATAAT
    GATGATATATCTAAATTTAATGCTTTATTTGAAGATGTAGAACAATTTTTAAATATTTAA
    60
    120
    180
    240
    300
    360

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000635 [new locus tag: EGJ38_RS03170 ]
  • symbol: SarX
  • description: HTH-type transcriptional regulator SarX
  • length: 119
  • theoretical pI: 8.92951
  • theoretical MW: 14178.4
  • GRAVY: -0.447059

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 108.8)
    and 1 more
    Genetic information processing Protein synthesis tRNA aminoacylation histidine--tRNA ligase (TIGR00442; EC 6.1.1.21; HMM-score: 11.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 78.6)
    and 2 more
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 13.4)
    Linker_histone; linker histone H1 and H5 family (PF00538; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8749
    • Cytoplasmic Membrane Score: 0.0259
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0985
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00281
    • TAT(Tat/SPI): 0.000277
    • LIPO(Sec/SPII): 0.000366
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422612 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]