Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000706 [new locus tag: EGJ38_RS03525 ]
- pan locus tag?: SAUPAN002639000
- symbol: sstC
- pan gene symbol?: sstC
- synonym: JSNZ_000706
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000706 [new locus tag: EGJ38_RS03525 ]
- symbol: sstC
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 741243..742004
- length: 762
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422683 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGATTCAAGTTGAAAATTTAACTAAAACTATAAATAATCAAATGATATTGGAAGATATT
AGCATAGATATCGAAAAAGGTAAATTGACTTCTTTAATTGGACCTAATGGTGCGGGTAAG
AGTACTTTACTTTCAGCGATATGTAGGTTAATTCGTTTTGATAACGGTGAAGTGAAAATA
GATGGACAGCTCATGTCTGATTATAAAAATAATGACTTGTCGAAAAAAATATCTATATTA
AAACAAACAAACCATACTGAAATGAATATTACGGTAGAGCAGTTGGTAAACTTTGGACGA
TTCCCTTATTCTAAAGGTCGTTTGACGAAAGAGGATCATGATATTGTCAATGATGCGCTA
GATTTGTTGCAACTACAAGATATCAGAAATCGTAATATTAAGTCATTATCTGGTGGACAA
CGTCAGCGTGCATACATTGCAATGACAATAGCACAAGATACTGAATATATTTTGCTAGAT
GAACCATTAAATAATTTAGATATGAAGCATGCTGTTCAAATTATGCAAACGTTAAAAATG
TTAGCGCATAAAATGAATAAAGCGATTGTCATTGTGTTACATGATATTAACTTTGCGTCC
TGTTATTCAGATCAGATTGTAGCATTGAAAAACGGACAACTAGTTAAGTCAGATTTGAAA
GATAATGTCATTCAAAGTAGTGTTTTAAGTGATTTATATGACATGAATATTCAAATTGAA
CATATAAGAAATCAAAGGATTTGTTTATATTTTAAGGATTGA60
120
180
240
300
360
420
480
540
600
660
720
762
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000706 [new locus tag: EGJ38_RS03525 ]
- symbol: SstC
- description: ABC transporter ATP-binding protein
- length: 253
- theoretical pI: 7.12767
- theoretical MW: 28820.1
- GRAVY: -0.266008
⊟Function[edit | edit source]
- TIGRFAM: proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 175.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 159.4)and 78 moreTransport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 131.5)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 130.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 127.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 123)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 118.7)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 116.7)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 114.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 114.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 114.1)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 113.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 111.7)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 111.7)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 110.5)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 109.1)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 109)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 109)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 108.6)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 106.8)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 104.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 103)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 102.6)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 101.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 101.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 100.3)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 98.1)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 97.3)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 96.8)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 96.2)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 94.6)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 94.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 94.2)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 91.4)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 91.4)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 89.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 89.6)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 89.6)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 89.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 86.8)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 85.8)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 85.7)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 85.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 85.6)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 84.3)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 84.3)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 83)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 79.9)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 78.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 74.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 74.2)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 70.2)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 70.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 68.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 68.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 67.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 66.4)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 61.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 60.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 56.4)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 55.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 54)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 53.1)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 50.3)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 42.3)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 42.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 35.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 30.1)DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 20.3)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 16.8)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 16)DNA metabolism DNA replication, recombination, and repair DNA repair protein RecN (TIGR00634; HMM-score: 15.7)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.2)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.2)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14.2)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14.2)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 116.4)and 24 moreAAA_15; AAA ATPase domain (PF13175; HMM-score: 42.2)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 37.4)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 36.4)AAA_23; AAA domain (PF13476; HMM-score: 36.4)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 26.3)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 20)AAA_27; AAA domain (PF13514; HMM-score: 18.8)ABC_ATPase; P-loop domain (PF09818; HMM-score: 17.9)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 17.6)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 17.4)EF_hand (CL0220) CAPN13-like_C_EFh; Calpain-13-like, C-terminal EF-hand (PF21875; HMM-score: 15.5)P-loop_NTPase (CL0023) AAA_25; AAA domain (PF13481; HMM-score: 15.4)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 15.3)AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.3)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15)AAA_14; AAA domain (PF13173; HMM-score: 14.7)AAA_30; AAA domain (PF13604; HMM-score: 14)DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 13.9)NTPase_1; NTPase (PF03266; HMM-score: 13.4)AAA_19; AAA domain (PF13245; HMM-score: 13.3)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 12.8)AAA_33; AAA domain (PF13671; HMM-score: 12.3)NACHT; NACHT domain (PF05729; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.3005
- Cytoplasmic Membrane Score: 0.6928
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0065
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010585
- TAT(Tat/SPI): 0.000521
- LIPO(Sec/SPII): 0.000374
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422683 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLSAICRLIRFDNGEVKIDGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYSKGRLTKEDHDIVNDALDLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPLNNLDMKHAVQIMQTLKMLAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDNVIQSSVLSDLYDMNIQIEHIRNQRICLYFKD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Fur/JSNZ_001486 (repression) regulon
Fur/JSNZ_001486 (TF) important in Iron homeostasis; regulation predicted or transferred from N315 and NCTC 8325 [2]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)