From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000899 [new locus tag: EGJ38_RS04490 ]
  • pan locus tag?: SAUPAN003035000
  • symbol: nfu
  • pan gene symbol?: nfu
  • synonym:
  • alternate name: JSNZ_000899
  • product: NifU family protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000899 [new locus tag: EGJ38_RS04490 ]
  • symbol: nfu
  • product: NifU family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 896678..896920
  • length: 243
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422871 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCCTACTGAAGATACAACGATGTTTGATCAAGTAGCAGAAGTTATTGAACGTCTTCGT
    CCATTTTTATTACGTGATGGTGGCGACTGCTCATTGATTGACGTGGAAGACGGTATTGTT
    AAATTACAATTACATGGTGCATGTGGTACATGCCCAAGTTCTACAATCACTCTTAAAGCT
    GGTATTGAGCGTGCATTACACGAAGAAGTGCCTGGTGTAATAGAAGTAGAACAAGTATTC
    TAA
    60
    120
    180
    240
    243


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000899 [new locus tag: EGJ38_RS04490 ]
  • symbol: Nfu
  • description: NifU family protein
  • length: 80
  • theoretical pI: 4.10599
  • theoretical MW: 8740.95
  • GRAVY: 0.08625

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 57.2)
    Metabolism Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 57.2)
    and 1 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other IscR-regulated protein YhgI (TIGR03341; HMM-score: 40)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    NifU (CL0232) NifU; NifU-like domain (PF01106; HMM-score: 93.5)
    and 2 more
    FeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 14.7)
    Gal_mutarotase (CL0103) DUF4432; Domain of unknown function (DUF4432) (PF14486; HMM-score: 10.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9961
    • Cytoplasmic Membrane Score: 0.0014
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0024
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.04606
    • TAT(Tat/SPI): 0.010062
    • LIPO(Sec/SPII): 0.000738
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422871 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MPTEDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEVEQVF

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]