Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000949 [new locus tag: EGJ38_RS04740 ]
- pan locus tag?: SAUPAN003136000
- symbol: opp3F
- pan gene symbol?: opp3F
- synonym:
- alternate name: JSNZ_000949
- product: ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000949 [new locus tag: EGJ38_RS04740 ]
- symbol: opp3F
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 952822..953763
- length: 942
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422920 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGAAAAATGATGAAGTGCTATTATCCATTAAAAATTTAAAGCAATATTTTAACGCAGGA
AAGAAAAACGAAGTGAGAGCGATTGAAAATATTTCGTTTGATATATACAAAGGGGAAACA
TTAGGTTTAGTAGGAGAATCGGGGTGTGGTAAATCTACAACTGGTAAATCAATTATTAAA
CTTAATGATATTACAAGTGGAGAAATTTTGTATGAGGGTATTGATATACAAAAGATTCGT
AAACGTAAAGATTTGCTTAAATTTAATAAAAAGATACAGATGATTTTTCAAGACCCATAT
GCGTCTTTAAATCCTAGGTTAAAAGTAATGGATATAGTAGCTGAAGGTATTGATATCCAT
CATTTAGCAACTGATAAACGTGACCGTAAAAAACGTGTCTATGATTTACTTGAAACTGTT
GGATTAAGTAAAGAACATGCCAATCGCTATCCTCATGAATTTTCAGGTGGACAACGCCAA
CGTATTGGAATTGCCCGTGCATTAGCCGTTGAACCAGAATTTATTATCGCGGACGAACCA
ATATCGGCATTGGATGTTTCAATCCAAGCTCAAGTAGTTAATTTATTATTAAAATTACAA
CGTGAAAGAGGGATTACGTTCCTATTTATAGCTCATGATCTATCAATGGTGAAGTATATT
TCAGATCGTATTGCAGTGATGCATTTTGGGAAAATAGTTGAAATTGGACCGGCAGAAGAA
ATTTATCAAAATCCATTACACGATTATACTAAGTCTTTATTATCAGCCATTCCACAACCT
GATCCTGAATCAGAACGCAGTCGCAAACGATTTAGTTATATTCATGATGAAGCAAATAAT
CATTTAAGACAATTACATGAAATAAGACCACAGCATTTTGTCTTTAGTACTGAAGAAGAA
GCGGCACAACTACGAGAAAATAAATTGGTGACACAAAATTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
942
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000949 [new locus tag: EGJ38_RS04740 ]
- symbol: Opp3F
- description: ABC transporter ATP-binding protein
- length: 313
- theoretical pI: 8.81322
- theoretical MW: 35857.9
- GRAVY: -0.447923
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 241.5)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 195.2)and 70 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 192.8)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 175.3)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 168.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 168.1)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 167.6)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 166.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 164)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 161.3)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 157.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 152.3)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 147.1)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 146.9)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 145.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 142.4)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 138.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 134.7)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 125)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 120.6)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 120.6)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.8)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 116.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 116.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 116.5)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 114.7)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 114.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 114.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 107.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 107.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 106.3)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 106.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 105.9)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 105.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 105.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 105.6)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 105.6)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 104.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 103.9)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 102.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 100.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 97.8)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 95.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 95)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 93.8)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 92.7)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 91)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 89.8)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 88.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 84.5)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 83.9)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 82.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 78.8)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 76.7)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 69.7)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 67.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 67.5)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 59.5)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 57.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 57.1)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 48.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 45.4)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 44.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 42.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 41.1)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 41.1)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36)Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 34.7)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 29.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 120.5)and 8 moreno clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 35.7)P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 25.9)AAA_22; AAA domain (PF13401; HMM-score: 17.2)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 15.6)AIG1; AIG1 family (PF04548; HMM-score: 15.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.7)AAA_13; AAA domain (PF13166; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1174
- Cytoplasmic Membrane Score: 0.8644
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0179
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.105461
- TAT(Tat/SPI): 0.001509
- LIPO(Sec/SPII): 0.00521
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422920 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIKLNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIHHLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEPISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEEIYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIHDEANNHLRQLHEIRPQHFVFSTEEEAAQLRENKLVTQN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; regulation predicted or transferred from N315 and NCTC 8325 [2]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Aurelia Hiron, Elise Borezée-Durant, Jean-Christophe Piard, Vincent Juillard
Only one of four oligopeptide transport systems mediates nitrogen nutrition in Staphylococcus aureus.
J Bacteriol: 2007, 189(14);5119-29
[PubMed:17496096] [WorldCat.org] [DOI] (P p)