Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000999 [new locus tag: EGJ38_RS04990 ]
- pan locus tag?: SAUPAN003236000
- symbol: EGJ38_000999
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000999
- product: DoxX family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000999 [new locus tag: EGJ38_RS04990 ]
- symbol: EGJ38_000999
- product: DoxX family protein
- replicon: chromosome
- strand: -
- coordinates: 1002737..1003093
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422968 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAATTAGGTATGCTTTTAATTAGATGGATGTTAGCAACATCATTCTTAGTGCATGGT
ACTTTGAAATTTGTTGATTTAGATGGAACAATTCACTTCTTAGGCTCTTTAGGTTTACCA
CCTACCATCGCAGTATTGATGTCAATTGGTGAAGTTGTTGGAGGTTTAGCACTTATTATC
GGCTTTTTAACGCCTTATGTTAATGTTTTTTATATTTGTGTTATGTTAGGCTCAATCTTC
ACACTTAAACTTACAAGAGGATATGTAAGTGGTTATGAATTTGAAATCATACATATCGTA
ATGAACTTAGCTTGTATTAGTAGTTACAGCTGGAAGAAATGGCTACAATTTTATTAA60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000999 [new locus tag: EGJ38_RS04990 ]
- symbol: EGJ38_000999
- description: DoxX family protein
- length: 118
- theoretical pI: 8.68513
- theoretical MW: 13228.9
- GRAVY: 0.988983
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: DoxD-like (CL0131) DoxX; DoxX (PF07681; HMM-score: 69.1)and 2 moreMauE; Methylamine utilisation protein MauE (PF07291; HMM-score: 28.2)DoxX_2; DoxX-like family (PF13564; HMM-score: 21.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0003
- Cytoplasmic Membrane Score: 0.9962
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0035
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.055871
- TAT(Tat/SPI): 0.000234
- LIPO(Sec/SPII): 0.064488
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422968 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLGMLLIRWMLATSFLVHGTLKFVDLDGTIHFLGSLGLPPTIAVLMSIGEVVGGLALIIGFLTPYVNVFYICVMLGSIFTLKLTRGYVSGYEFEIIHIVMNLACISSYSWKKWLQFY
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]