Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001110 [new locus tag: EGJ38_RS05545 ]
- pan locus tag?: SAUPAN003383000
- symbol: trxA
- pan gene symbol?: trxA
- synonym:
- product: thioredoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001110 [new locus tag: EGJ38_RS05545 ]
- symbol: trxA
- product: thioredoxin
- replicon: chromosome
- strand: +
- coordinates: 1116010..1116324
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423079 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAATCGTAAAAGTAACAGATGCAGATTTCGATTCAAAAGTAGAATCTGGTGTACAA
TTAGTAGATTTTTGGGCAACATGGTGTGGTCCATGTAAAATGATCGCTCCGGTATTAGAA
GAATTAGCAGCTGACTATGAAGGTAAAGCTGACATTTTAAAATTAGATGTTGATGAAAAT
CCATCAACTGCAGCTAAATATGAAGTGATGAGTATTCCAACATTAATCGTCTTTAAAGAC
GGTCAACCAGTTGATAAAGTTGTTGGTTTCCAACCAAAAGAAAACTTAGCTGAAGTTTTA
GATAAACATTTATAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001110 [new locus tag: EGJ38_RS05545 ]
- symbol: TrxA
- description: thioredoxin
- length: 104
- theoretical pI: 4.14487
- theoretical MW: 11440.1
- GRAVY: 0.0288462
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 132.2)and 9 moreProtein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 65.5)protein disulfide isomerase (TIGR01130; HMM-score: 56.6)Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 34.4)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 31.6)glutaredoxin-like domain protein (TIGR02187; HMM-score: 24.2)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 22.3)glutaredoxin-like protein (TIGR02200; HMM-score: 22.1)Central intermediary metabolism Sulfur metabolism 5'-adenylylsulfate reductase, thioredoxin-independent (TIGR00424; HMM-score: 14.9)type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 115.4)and 13 moreThioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 37.9)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 33.4)Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 24.8)Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 23.7)AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 21.8)KaiB; KaiB domain (PF07689; HMM-score: 20.3)Redoxin; Redoxin (PF08534; HMM-score: 19.4)Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 19.1)OST3_OST6; OST3 / OST6 family, transporter family (PF04756; HMM-score: 18.4)TraF; F plasmid transfer operon protein (PF13728; HMM-score: 16.5)HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 16.1)DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 13.8)Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9468
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0
- Extracellular Score: 0.0527
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01275
- TAT(Tat/SPI): 0.000543
- LIPO(Sec/SPII): 0.001187
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423079 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAIVKVTDADFDSKVESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]