Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1155 [new locus tag: SACOL_RS05900 ]
- pan locus tag?: SAUPAN003383000
- symbol: trxA
- pan gene symbol?: trxA
- synonym:
- product: thioredoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1155 [new locus tag: SACOL_RS05900 ]
- symbol: trxA
- product: thioredoxin
- replicon: chromosome
- strand: +
- coordinates: 1165588..1165902
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237320 NCBI
- RefSeq: YP_186018 NCBI
- BioCyc: see SACOL_RS05900
- MicrobesOnline: 912622 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAATCGTAAAAGTAACAGATGCAGATTTTGATTCAAAAGTAGAATCTGGTGTACAA
CTAGTAGATTTTTGGGCAACATGGTGTGGTCCATGTAAAATGATCGCTCCGGTATTAGAA
GAATTAGCAGCTGACTATGAAGGTAAAGCTGACATTTTAAAATTAGATGTTGATGAAAAT
CCATCAACTGCAGCTAAATATGAAGTGATGAGTATTCCAACATTAATCGTCTTTAAAGAC
GGTCAACCAGTTGATAAAGTTGTTGGTTTCCAACCAAAAGAAAACTTAGCTGAAGTTTTA
GATAAACATTTATAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1155 [new locus tag: SACOL_RS05900 ]
- symbol: TrxA
- description: thioredoxin
- length: 104
- theoretical pI: 4.14487
- theoretical MW: 11440.1
- GRAVY: 0.0288462
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 132.2)and 9 moreProtein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 65.5)protein disulfide isomerase (TIGR01130; HMM-score: 56.6)Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 34.4)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 31.6)glutaredoxin-like domain protein (TIGR02187; HMM-score: 24.2)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 22.3)glutaredoxin-like protein (TIGR02200; HMM-score: 22.1)Central intermediary metabolism Sulfur metabolism 5'-adenylylsulfate reductase, thioredoxin-independent (TIGR00424; HMM-score: 14.9)type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
- TheSEED :
- Thioredoxin
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 113.1)and 14 moreThioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 36.5)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 31.5)Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 24.8)Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 24.6)AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 19.6)KaiB; KaiB domain (PF07689; HMM-score: 18)Redoxin; Redoxin (PF08534; HMM-score: 18)OST3_OST6; OST3 / OST6 family, transporter family (PF04756; HMM-score: 17.3)DUF836; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 16.7)TraF; F plasmid transfer operon protein (PF13728; HMM-score: 16)Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 15.2)HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 14.9)Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 14.9)DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01275
- TAT(Tat/SPI): 0.000543
- LIPO(Sec/SPII): 0.001187
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAIVKVTDADFDSKVESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 7846 [5]
- interaction partners:
SACOL1637 (dnaK) molecular chaperone DnaK [6] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [6] (data from MRSA252) SACOL0593 (fusA) elongation factor G [6] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [6] (data from MRSA252) SACOL1288 (infB) translation initiation factor IF-2 [6] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [6] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [6] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [6] (data from MRSA252) SACOL0539 (purR) pur operon repressor [6] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [6] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [6] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [6] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [6] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [6] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [6] (data from MRSA252) SACOL2212 (rplQ) 50S ribosomal protein L17 [6] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [6] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [6] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [6] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [6] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [6] (data from MRSA252) SACOL0589 (rpoC) DNA-directed RNA polymerase subunit beta' [6] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [6] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [6] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [6] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [6] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [6] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [6] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [6] (data from MRSA252) SACOL0944 NADH dehydrogenase [6] (data from MRSA252) SACOL0973 fumarylacetoacetate hydrolase [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 34.93 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 6.11 6.12 6.13 6.14 6.15 6.16 6.17 6.18 6.19 6.20 6.21 6.22 6.23 6.24 6.25 6.26 6.27 6.28 6.29 6.30 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]