From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001279 [new locus tag: EGJ38_RS06390 ]
  • pan locus tag?: SAUPAN003625000
  • symbol: glnR
  • pan gene symbol?: glnR
  • synonym: JSNZ_001279
  • product: MerR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001279 [new locus tag: EGJ38_RS06390 ]
  • symbol: glnR
  • product: MerR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 1297027..1297395
  • length: 369
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423244 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATATCGAATGATGCAATCAGACGAAATATGGCTGTCTTCTCTATGAGTGTAGTAAGT
    AAGTTAACGGATTTAACGCCAAGGCAAATACGTTACTATGAAACACATGAACTCATCAAA
    CCTGAAAGAACAGAAGGTCAAAAACGTCTGTTCTCACTCAATGATTTGGAAAGATTACTA
    GAAATTAAATCATTATTAGAAAAAGGATTTAATATCAAAGGGATTAAGCAAATCATTTAT
    GACTCACAAGAGCATTTAACAACTGATGAACAAGAGATAAGAAAAAAGATGATTGTAGAT
    GCCACGCAAAAGCCTATTGGAGAAACTTTGCCAATAAATCGTGGTGATTTATCCCGATTT
    ATTAAATAA
    60
    120
    180
    240
    300
    360
    369

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001279 [new locus tag: EGJ38_RS06390 ]
  • symbol: GlnR
  • description: MerR family transcriptional regulator
  • length: 122
  • theoretical pI: 9.8101
  • theoretical MW: 14276.5
  • GRAVY: -0.546721

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 34)
    Cellular processes Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)
    Signal transduction Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)
    Signal transduction Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 33)
    and 4 more
    Signal transduction Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 23.9)
    Cellular processes Cellular processes Detoxification redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)
    Signal transduction Regulatory functions DNA interactions redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12.2)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 70)
    and 4 more
    MerR; MerR family regulatory protein (PF00376; HMM-score: 43)
    no clan defined PDGF_N; Platelet-derived growth factor, N terminal region (PF04692; HMM-score: 15.2)
    HTH (CL0123) MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 14.5)
    KNTase_C (CL0291) DUF5667; Domain of unknown function (DUF5667) (PF18915; HMM-score: 13.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effector: Feedback-inhibited GlnA (glutamine synthetase)
  • genes regulated by GlnR/JSNZ_001279, TF important in Nitrogen assimilationsee RegPrecise for N315
    repression

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9375
    • Cytoplasmic Membrane Score: 0.0423
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0196
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005097
    • TAT(Tat/SPI): 0.004677
    • LIPO(Sec/SPII): 0.003218
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423244 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MISNDAIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLNDLERLLEIKSLLEKGFNIKGIKQIIYDSQEHLTTDEQEIRKKMIVDATQKPIGETLPINRGDLSRFIK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: CodY/JSNZ_001225 (repression) regulon, GlnR/JSNZ_001279 (repression) regulon
    CodY/JSNZ_001225(TF)important in Amino acid metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [2]
    GlnR/JSNZ_001279(TF)important in Nitrogen assimilation;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. 2.0 2.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]