Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1328 [new locus tag: SACOL_RS06765 ]
- pan locus tag?: SAUPAN003625000
- symbol: glnR
- pan gene symbol?: glnR
- synonym:
- product: glutamine synthetase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1328 [new locus tag: SACOL_RS06765 ]
- symbol: glnR
- product: glutamine synthetase
- replicon: chromosome
- strand: +
- coordinates: 1346195..1346563
- length: 369
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236141 NCBI
- RefSeq: YP_186183 NCBI
- BioCyc: see SACOL_RS06765
- MicrobesOnline: 912789 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATATCGAATGATGCAATCAGACGAAATATGGCTGTCTTCTCTATGAGTGTAGTAAGT
AAGTTAACGGATTTAACGCCAAGGCAAATACGTTACTATGAAACACATGAACTCATCAAA
CCTGAAAGAACAGAAGGTCAAAAACGTCTGTTCTCACTCAATGATTTGGAAAGATTACTA
GAAATTAAATCATTATTAGAAAAAGGATTTAATATCAAAGGGATTAAACAAATCATTTAT
GACTCACAAGAGCATTTAACAACAGATGAACAAGAGATAAGAAAAAAGATGATTGTAGAT
GCCACGCAAAAGCCTATTGGAGAAACTTTGCCAATAAATCGTGGTGATTTATCCCGATTT
ATTAAATAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1328 [new locus tag: SACOL_RS06765 ]
- symbol: GlnR
- description: glutamine synthetase
- length: 122
- theoretical pI: 9.8101
- theoretical MW: 14276.5
- GRAVY: -0.546721
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 34)Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 33)and 4 moreRegulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 23.9)Cellular processes Detoxification redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)Regulatory functions DNA interactions redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12.2)
- TheSEED :
- FemC, factor involved in methicillin resistance
- Glutamine synthetase repressor
- PFAM: HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 70)and 4 moreMerR; MerR family regulatory protein (PF00376; HMM-score: 43)no clan defined PDGF_N; Platelet-derived growth factor, N terminal region (PF04692; HMM-score: 15.2)HTH (CL0123) MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 14.5)KNTase_C (CL0291) DUF5667; Domain of unknown function (DUF5667) (PF18915; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Feedback-inhibited GlnA (glutamine synthetase)
- genes regulated by GlnR, TF important in Nitrogen assimilationRegPrecisetranscription units transferred from N315 data RegPrecise
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9375
- Cytoplasmic Membrane Score: 0.0423
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0196
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005097
- TAT(Tat/SPI): 0.004677
- LIPO(Sec/SPII): 0.003218
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MISNDAIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLNDLERLLEIKSLLEKGFNIKGIKQIIYDSQEHLTTDEQEIRKKMIVDATQKPIGETLPINRGDLSRFIK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 16 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: CodY (repression) regulon, GlnR (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise GlnR (TF) important in Nitrogen assimilation; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)