Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS06765 [old locus tag: SACOL1328 ]
- pan locus tag?: SAUPAN003625000
- symbol: SACOL_RS06765
- pan gene symbol?: glnR
- synonym:
- product: MerR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS06765 [old locus tag: SACOL1328 ]
- symbol: SACOL_RS06765
- product: MerR family transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 1346195..1346563
- length: 369
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATATCGAATGATGCAATCAGACGAAATATGGCTGTCTTCTCTATGAGTGTAGTAAGT
AAGTTAACGGATTTAACGCCAAGGCAAATACGTTACTATGAAACACATGAACTCATCAAA
CCTGAAAGAACAGAAGGTCAAAAACGTCTGTTCTCACTCAATGATTTGGAAAGATTACTA
GAAATTAAATCATTATTAGAAAAAGGATTTAATATCAAAGGGATTAAACAAATCATTTAT
GACTCACAAGAGCATTTAACAACAGATGAACAAGAGATAAGAAAAAAGATGATTGTAGAT
GCCACGCAAAAGCCTATTGGAGAAACTTTGCCAATAAATCGTGGTGATTTATCCCGATTT
ATTAAATAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS06765 [old locus tag: SACOL1328 ]
- symbol: SACOL_RS06765
- description: MerR family transcriptional regulator
- length: 122
- theoretical pI: 9.8101
- theoretical MW: 14276.5
- GRAVY: -0.546721
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 34)Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 33)and 4 moreRegulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 23.9)Cellular processes Detoxification redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)Regulatory functions DNA interactions redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12.2)
- TheSEED: see SACOL1328
- PFAM: HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 71.6)and 3 moreMerR; MerR family regulatory protein (PF00376; HMM-score: 43.5)MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 14.5)no clan defined PDGF_N; Platelet-derived growth factor, N terminal region (PF04692; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005097
- TAT(Tat/SPI): 0.004677
- LIPO(Sec/SPII): 0.003218
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000624945 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MISNDAIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLNDLERLLEIKSLLEKGFNIKGIKQIIYDSQEHLTTDEQEIRKKMIVDATQKPIGETLPINRGDLSRFIK
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1328
- protein localization: see SACOL1328
- quantitative data / protein copy number per cell: see SACOL1328
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]