Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001406 [new locus tag: EGJ38_RS07020 ]
- pan locus tag?: SAUPAN003852000
- symbol: EGJ38_001406
- pan gene symbol?: —
- synonym:
- product: YozE family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001406 [new locus tag: EGJ38_RS07020 ]
- symbol: EGJ38_001406
- product: YozE family protein
- replicon: chromosome
- strand: -
- coordinates: 1422236..1422457
- length: 222
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423368 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAAAACTATTCGTTTTATCAATTTGTCATGACAGTTCGTGGTCGACACGACGATAAA
GGTCGTCTAGCAGAAGAGATATTTGACGATCTTGCTTTCCCAAAACACGATGATGATTTT
AACATACTGTCTGATTATATTGAGACACATGGTGATTTCACATTGCCAATGTCTGTATTT
GATGATTTATATGAAGAATATACGGAATGGCTAAAATTTTAA60
120
180
222
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001406 [new locus tag: EGJ38_RS07020 ]
- symbol: EGJ38_001406
- description: YozE family protein
- length: 73
- theoretical pI: 4.14928
- theoretical MW: 8869.76
- GRAVY: -0.617808
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined YozE_SAM_like; YozE SAM-like fold (PF06855; HMM-score: 80.7)and 1 moreP-loop_NTPase (CL0023) Terminase_6N; Terminase large subunit, T4likevirus-type, N-terminal (PF03237; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7875
- Cytoplasmic Membrane Score: 0.0068
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.2057
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011149
- TAT(Tat/SPI): 0.000218
- LIPO(Sec/SPII): 0.001612
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423368 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKNYSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKF
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_001406 < crr < msrB < msrA1
⊟Regulation[edit | edit source]
- regulator: VraR (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
Mol Microbiol: 2003, 49(3);807-21
[PubMed:12864861] [WorldCat.org] [DOI] (P p) - ↑ Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
Antimicrob Agents Chemother: 2013, 57(1);83-95
[PubMed:23070169] [WorldCat.org] [DOI] (I p)