From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001470 [new locus tag: EGJ38_RS07340 ]
  • pan locus tag?: SAUPAN003949000
  • symbol: fer
  • pan gene symbol?: fer
  • synonym:
  • alternate name: JSNZ_001470
  • product: ferredoxin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001470 [new locus tag: EGJ38_RS07340 ]
  • symbol: fer
  • product: ferredoxin
  • replicon: chromosome
  • strand: +
  • coordinates: 1515779..1516027
  • length: 249
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423430 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGGCAAAATATACAATCGTTGATATGGATACTTGTATTGCATGTGGTGCATGCGGTGCA
    GCAGCGCCAGATATATATGATTACGACGACGAAGGTATTGCTTTCGTAATCCTTGACGAT
    AACCAAGGTACTGCAGAAGTACCTGAGGAATTATATGAAGATATGGAAGATGCAATTGAT
    GGATGCCCTACAGATTCTATTAAAATTGCAGACGAATCATTTGATGGGGACGCTTTAAAA
    TTTGAATAA
    60
    120
    180
    240
    249

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001470 [new locus tag: EGJ38_RS07340 ]
  • symbol: Fer
  • description: ferredoxin
  • length: 82
  • theoretical pI: 3.24434
  • theoretical MW: 8840.62
  • GRAVY: -0.147561

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport NADH-quinone oxidoreductase, chain I (TIGR01971; HMM-score: 14.6)
    Metabolism Central intermediary metabolism Sulfur metabolism sulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 13.7)
    Metabolism Energy metabolism Electron transport cytochrome c nitrite reductase, Fe-S protein (TIGR03149; EC 1.7.2.2; HMM-score: 12.5)
    and 3 more
    Metabolism Energy metabolism Anaerobic formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 11.6)
    Metabolism Energy metabolism Electron transport formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 11.6)
    [FeFe] hydrogenase, group B1/B3 (TIGR04105; EC 1.12.-.-; HMM-score: 9.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    4Fe-4S (CL0344) Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 69.8)
    and 8 more
    Fer4_15; 4Fe-4S single cluster domain (PF13459; HMM-score: 52.3)
    Fer4; 4Fe-4S binding domain (PF00037; HMM-score: 20.9)
    Fer4_2; 4Fe-4S binding domain (PF12797; HMM-score: 17.2)
    Fer4_10; 4Fe-4S dicluster domain (PF13237; HMM-score: 15.1)
    Fer4_21; 4Fe-4S dicluster domain (PF14697; HMM-score: 14.8)
    Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 14.2)
    Fer4_6; 4Fe-4S binding domain (PF12837; HMM-score: 13.6)
    Fer4_19; Divergent 4Fe-4S mono-cluster (PF06902; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8953
    • Cytoplasmic Membrane Score: 0.0144
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0903
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.034013
    • TAT(Tat/SPI): 0.000761
    • LIPO(Sec/SPII): 0.02837
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423430 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAKYTIVDMDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAIDGCPTDSIKIADESFDGDALKFE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]