Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001470 [new locus tag: EGJ38_RS07340 ]
- pan locus tag?: SAUPAN003949000
- symbol: fer
- pan gene symbol?: fer
- synonym:
- alternate name: JSNZ_001470
- product: ferredoxin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001470 [new locus tag: EGJ38_RS07340 ]
- symbol: fer
- product: ferredoxin
- replicon: chromosome
- strand: +
- coordinates: 1515779..1516027
- length: 249
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423430 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGGCAAAATATACAATCGTTGATATGGATACTTGTATTGCATGTGGTGCATGCGGTGCA
GCAGCGCCAGATATATATGATTACGACGACGAAGGTATTGCTTTCGTAATCCTTGACGAT
AACCAAGGTACTGCAGAAGTACCTGAGGAATTATATGAAGATATGGAAGATGCAATTGAT
GGATGCCCTACAGATTCTATTAAAATTGCAGACGAATCATTTGATGGGGACGCTTTAAAA
TTTGAATAA60
120
180
240
249
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001470 [new locus tag: EGJ38_RS07340 ]
- symbol: Fer
- description: ferredoxin
- length: 82
- theoretical pI: 3.24434
- theoretical MW: 8840.62
- GRAVY: -0.147561
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport NADH-quinone oxidoreductase, chain I (TIGR01971; HMM-score: 14.6)Central intermediary metabolism Sulfur metabolism sulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 13.7)Energy metabolism Electron transport cytochrome c nitrite reductase, Fe-S protein (TIGR03149; EC 1.7.2.2; HMM-score: 12.5)and 3 moreEnergy metabolism Anaerobic formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 11.6)Energy metabolism Electron transport formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 11.6)[FeFe] hydrogenase, group B1/B3 (TIGR04105; EC 1.12.-.-; HMM-score: 9.8)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: 4Fe-4S (CL0344) Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 69.8)and 8 moreFer4_15; 4Fe-4S single cluster domain (PF13459; HMM-score: 52.3)Fer4; 4Fe-4S binding domain (PF00037; HMM-score: 20.9)Fer4_2; 4Fe-4S binding domain (PF12797; HMM-score: 17.2)Fer4_10; 4Fe-4S dicluster domain (PF13237; HMM-score: 15.1)Fer4_21; 4Fe-4S dicluster domain (PF14697; HMM-score: 14.8)Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 14.2)Fer4_6; 4Fe-4S binding domain (PF12837; HMM-score: 13.6)Fer4_19; Divergent 4Fe-4S mono-cluster (PF06902; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8953
- Cytoplasmic Membrane Score: 0.0144
- Cell wall & surface Score: 0
- Extracellular Score: 0.0903
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.034013
- TAT(Tat/SPI): 0.000761
- LIPO(Sec/SPII): 0.02837
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423430 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKYTIVDMDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAIDGCPTDSIKIADESFDGDALKFE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]