From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001518 [new locus tag: EGJ38_RS07580 ]
  • pan locus tag?: SAUPAN004082000
  • symbol: accB
  • pan gene symbol?: accB
  • synonym:
  • alternate name: JSNZ_001518
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001518 [new locus tag: EGJ38_RS07580 ]
  • symbol: accB
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1560497..1560961
  • length: 465
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423475 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAACTTTAAAGAAATCAAAGAATTAATTGAAATTCTGGATAAATCAACTTTAACGGAA
    ATCAATATTGAAGATACTAAAGGCAAAGTGACGCTTAAGAAAGAAAAAGAAACTGAGATT
    ATCACGCCACAAATCTCACAAATGCCAGTTGAAGCTGCGGCAATGCCTATGCCTCAAGCA
    CAATCAACTGATAGCAATAAAACTGAAGCTCCAAAGCCAACTTCAGATAATCACAAAACA
    ATTAATGCACCTATGGTAGGTACATTTTACAAATCGCCATCTCCAGACGAAGAAGCATAT
    GTGCAAGTTGGGGACACTGTTTCAAATGAAACAACAGTGTGTATTTTAGAGGCAATGAAA
    CTATTTAATGAAATTCAAGCAGAAATTTCAGGTGAAATTGTTGAAATCTTAGTAGAAGAC
    GGACAAATGGTAGAGTATGGCCAACCGTTATTTAAGGTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001518 [new locus tag: EGJ38_RS07580 ]
  • symbol: AccB
  • description: acetyl-CoA carboxylase biotin carboxyl carrier protein
  • length: 154
  • theoretical pI: 4.2253
  • theoretical MW: 17121.4
  • GRAVY: -0.423377

Function[edit | edit source]

  • reaction:
    EC 6.4.1.2?  ExPASy
    Acetyl-CoA carboxylase ATP + acetyl-CoA + HCO3(-) = ADP + phosphate + malonyl-CoA
  • TIGRFAM:
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 170.6)
    and 16 more
    Metabolism Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 39.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)
    Metabolism Energy metabolism Other oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)
    Metabolism Energy metabolism Pyruvate dehydrogenase dihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 31.1)
    Metabolism Energy metabolism Glycolysis/gluconeogenesis pyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 30.1)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 22.2)
    Metabolism Transport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 22)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)
    Metabolism Transport and binding proteins Other efflux pump membrane protein (TIGR00998; HMM-score: 15)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 14.9)
    Cell structure Cell envelope Other uncharacterized lipoprotein (TIGR02722; HMM-score: 14.7)
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 13.7)
    Metabolism Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 13.3)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair UV excision repair protein Rad23 (TIGR00601; HMM-score: 13)
    2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 10.2)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 81.7)
    and 7 more
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 30.2)
    GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 18.6)
    HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 17.5)
    no clan defined EPL1; Enhancer of polycomb-like (PF10513; HMM-score: 15)
    Hybrid (CL0105) HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 14.2)
    no clan defined PCM1_C; Pericentriolar material 1 C terminus (PF15717; HMM-score: 13.2)
    Dicty_REP; Dictyostelium (Slime Mold) REP protein (PF05086; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9914
    • Cytoplasmic Membrane Score: 0.0044
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0039
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.063844
    • TAT(Tat/SPI): 0.002354
    • LIPO(Sec/SPII): 0.001119
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423475 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQAQSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMKLFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]