Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001513 [new locus tag: EGJ38_RS07555 ]
- pan locus tag?: SAUPAN004077000
- symbol: xseB
- pan gene symbol?: xseB
- synonym:
- alternate name: JSNZ_001513
- product: exodeoxyribonuclease VII small subunit
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001513 [new locus tag: EGJ38_RS07555 ]
- symbol: xseB
- product: exodeoxyribonuclease VII small subunit
- replicon: chromosome
- strand: -
- coordinates: 1556739..1556969
- length: 231
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423470 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACTAAAGAAACGCAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCAAATTGTTCAA
AAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATATCAACGTGGTATG
AAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAATGACTTA
ATAAAAGAAGAAGCTGAGGATGTAAAAAATGACGAATCTACCGATGAATAA60
120
180
231
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001513 [new locus tag: EGJ38_RS07555 ]
- symbol: XseB
- description: exodeoxyribonuclease VII small subunit
- length: 76
- theoretical pI: 3.9341
- theoretical MW: 8759.64
- GRAVY: -0.977632
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism Degradation of DNA exodeoxyribonuclease VII, small subunit (TIGR01280; EC 3.1.11.6; HMM-score: 81)and 2 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.3)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobN subunit (TIGR02257; EC 6.6.1.2; HMM-score: 11)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined Exonuc_VII_S; Exonuclease VII small subunit (PF02609; HMM-score: 75.8)and 12 moreDUF2209; Uncharacterized protein conserved in archaea (DUF2209) (PF09974; HMM-score: 15)DUF7777; Domain of unknown function (DUF7777) (PF24992; HMM-score: 14.6)DASH_Dad2; DASH complex subunit Dad2 (PF08654; HMM-score: 13.6)ADIP; Afadin- and alpha -actinin-Binding (PF11559; HMM-score: 13.6)EsxAB (CL0352) EspA_EspE; EspA/EspE family (PF18879; HMM-score: 13.1)TPR (CL0020) HEAT_SCC3-SA; Cohesin subunit SCC3/SA, HEAT-repeats domain (PF24571; HMM-score: 13.1)no clan defined DUF1657; Protein of unknown function (DUF1657) (PF07870; HMM-score: 12.6)DUF2120; Uncharacterized protein conserved in archaea (DUF2120) (PF09893; HMM-score: 12.4)E2_bind; E2 binding domain (PF08825; HMM-score: 11.8)Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 11.5)IHF-likeDNA-bdg (CL0548) HU-CCDC81_bac_2; CCDC81-like prokaryotic HU domain 2 (PF18175; HMM-score: 11.4)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 8.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9826
- Cytoplasmic Membrane Score: 0.0139
- Cell wall & surface Score: 0.0022
- Extracellular Score: 0.0013
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009855
- TAT(Tat/SPI): 0.035215
- LIPO(Sec/SPII): 0.000826
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423470 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)