From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001513 [new locus tag: EGJ38_RS07555 ]
  • pan locus tag?: SAUPAN004077000
  • symbol: xseB
  • pan gene symbol?: xseB
  • synonym:
  • alternate name: JSNZ_001513
  • product: exodeoxyribonuclease VII small subunit

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001513 [new locus tag: EGJ38_RS07555 ]
  • symbol: xseB
  • product: exodeoxyribonuclease VII small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1556739..1556969
  • length: 231
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423470 NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACTAAAGAAACGCAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCAAATTGTTCAA
    AAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATATCAACGTGGTATG
    AAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAATGACTTA
    ATAAAAGAAGAAGCTGAGGATGTAAAAAATGACGAATCTACCGATGAATAA
    60
    120
    180
    231


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_001513 [new locus tag: EGJ38_RS07555 ]
  • symbol: XseB
  • description: exodeoxyribonuclease VII small subunit
  • length: 76
  • theoretical pI: 3.9341
  • theoretical MW: 8759.64
  • GRAVY: -0.977632

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, small subunit (TIGR01280; EC 3.1.11.6; HMM-score: 81)
    and 2 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobN subunit (TIGR02257; EC 6.6.1.2; HMM-score: 11)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined Exonuc_VII_S; Exonuclease VII small subunit (PF02609; HMM-score: 75.8)
    and 12 more
    DUF2209; Uncharacterized protein conserved in archaea (DUF2209) (PF09974; HMM-score: 15)
    DUF7777; Domain of unknown function (DUF7777) (PF24992; HMM-score: 14.6)
    DASH_Dad2; DASH complex subunit Dad2 (PF08654; HMM-score: 13.6)
    ADIP; Afadin- and alpha -actinin-Binding (PF11559; HMM-score: 13.6)
    EsxAB (CL0352) EspA_EspE; EspA/EspE family (PF18879; HMM-score: 13.1)
    TPR (CL0020) HEAT_SCC3-SA; Cohesin subunit SCC3/SA, HEAT-repeats domain (PF24571; HMM-score: 13.1)
    no clan defined DUF1657; Protein of unknown function (DUF1657) (PF07870; HMM-score: 12.6)
    DUF2120; Uncharacterized protein conserved in archaea (DUF2120) (PF09893; HMM-score: 12.4)
    E2_bind; E2 binding domain (PF08825; HMM-score: 11.8)
    Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 11.5)
    IHF-likeDNA-bdg (CL0548) HU-CCDC81_bac_2; CCDC81-like prokaryotic HU domain 2 (PF18175; HMM-score: 11.4)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 8.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9826
    • Cytoplasmic Membrane Score: 0.0139
    • Cell wall & surface Score: 0.0022
    • Extracellular Score: 0.0013
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009855
    • TAT(Tat/SPI): 0.035215
    • LIPO(Sec/SPII): 0.000826
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423470 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]