From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS07555 [old locus tag: EGJ38_001513 ]
  • pan locus tag?: SAUPAN004077000
  • symbol: EGJ38_RS07555
  • pan gene symbol?: xseB
  • synonym:
  • product: exodeoxyribonuclease VII small subunit

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS07555 [old locus tag: EGJ38_001513 ]
  • symbol: EGJ38_RS07555
  • product: exodeoxyribonuclease VII small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1556739..1556969
  • length: 231
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1556739..1556969) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACTAAAGAAACGCAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCAAATTGTTCAA
    AAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATATCAACGTGGTATG
    AAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAATGACTTA
    ATAAAAGAAGAAGCTGAGGATGTAAAAAATGACGAATCTACCGATGAATAA
    60
    120
    180
    231


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS07555 [old locus tag: EGJ38_001513 ]
  • symbol: EGJ38_RS07555
  • description: exodeoxyribonuclease VII small subunit
  • length: 76
  • theoretical pI: 3.9341
  • theoretical MW: 8759.64
  • GRAVY: -0.977632

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, small subunit (TIGR01280; EC 3.1.11.6; HMM-score: 81)
    and 2 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobN subunit (TIGR02257; EC 6.6.1.2; HMM-score: 11)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined Exonuc_VII_S; Exonuclease VII small subunit (PF02609; HMM-score: 75.8)
    and 12 more
    DUF2209; Uncharacterized protein conserved in archaea (DUF2209) (PF09974; HMM-score: 15)
    DUF7777; Domain of unknown function (DUF7777) (PF24992; HMM-score: 14.6)
    DASH_Dad2; DASH complex subunit Dad2 (PF08654; HMM-score: 13.6)
    ADIP; Afadin- and alpha -actinin-Binding (PF11559; HMM-score: 13.6)
    EsxAB (CL0352) EspA_EspE; EspA/EspE family (PF18879; HMM-score: 13.1)
    TPR (CL0020) HEAT_SCC3-SA; Cohesin subunit SCC3/SA, HEAT-repeats domain (PF24571; HMM-score: 13.1)
    no clan defined DUF1657; Protein of unknown function (DUF1657) (PF07870; HMM-score: 12.6)
    DUF2120; Uncharacterized protein conserved in archaea (DUF2120) (PF09893; HMM-score: 12.4)
    E2_bind; E2 binding domain (PF08825; HMM-score: 11.8)
    Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 11.5)
    IHF-likeDNA-bdg (CL0548) HU-CCDC81_bac_2; CCDC81-like prokaryotic HU domain 2 (PF18175; HMM-score: 11.4)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 8.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9826
    • Cytoplasmic Membrane Score: 0.0139
    • Cell wall & surface Score: 0.0022
    • Extracellular Score: 0.0013
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009855
    • TAT(Tat/SPI): 0.035215
    • LIPO(Sec/SPII): 0.000826
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000159865 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]