From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
  • pan locus tag?: SAUPAN004077000
  • symbol: xseB
  • pan gene symbol?: xseB
  • synonym:
  • product: exodeoxyribonuclease VII small subunit

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
  • symbol: xseB
  • product: exodeoxyribonuclease VII small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1603544..1603774
  • length: 231
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACTAAAGAAACGCAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCAAATTGTTCAA
    AAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATATCAACGTGGTATG
    AAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAATGACTTA
    ATAAAAGAAGAAGCTGAGGATGTAAAAAATGACGAATCTACCGATGAATAA
    60
    120
    180
    231

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
  • symbol: XseB
  • description: exodeoxyribonuclease VII small subunit
  • length: 76
  • theoretical pI: 3.9341
  • theoretical MW: 8759.64
  • GRAVY: -0.977632

⊟Function[edit | edit source]

  • reaction:
    EC 3.1.11.6?  ExPASy
    Exodeoxyribonuclease VII Exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield nucleoside 5'-phosphates
  • TIGRFAM:
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, small subunit (TIGR01280; EC 3.1.11.6; HMM-score: 81)
    and 2 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobN subunit (TIGR02257; EC 6.6.1.2; HMM-score: 11)
  • TheSEED  :
    • Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)
    DNA Metabolism DNA repair DNA repair, bacterial  Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)
  • PFAM:
    no clan defined Exonuc_VII_S; Exonuclease VII small subunit (PF02609; HMM-score: 76.1)
    and 6 more
    DASH_Dad2; DASH complex subunit Dad2 (PF08654; HMM-score: 13.8)
    ADIP; Afadin- and alpha -actinin-Binding (PF11559; HMM-score: 13.2)
    DUF4359; Domain of unknown function (DUF4359) (PF14271; HMM-score: 12.8)
    DUF1657; Protein of unknown function (DUF1657) (PF07870; HMM-score: 12.7)
    DUF2120; Uncharacterized protein conserved in archaea (DUF2120) (PF09893; HMM-score: 12)
    Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 10.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009855
    • TAT(Tat/SPI): 0.035215
    • LIPO(Sec/SPII): 0.000826
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell: 536 [2]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1567&oldid=82928"