From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001524 [new locus tag: EGJ38_RS07610 ]
  • pan locus tag?: SAUPAN004111000
  • symbol: EGJ38_001524
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_001524
  • product: rhodanese-like domain-containing protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001524 [new locus tag: EGJ38_RS07610 ]
  • symbol: EGJ38_001524
  • product: rhodanese-like domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1565049..1565435
  • length: 387
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423481 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAGTGCTAGTTTGTACATCGCAATAATTTTAGTTATAGCAATTATTGCTTATATGATT
    GTTCAACAAATTCTTAACAAGCGAGCTGTTAAAGAATTAGATCAAAATGAATTCCATAAT
    GGGATTAGAAAAGCTCAAGTCATCGATGTTAGAGAGAAAGTTGACTATGACTACGGTCAC
    ATTAATGGGTCTCGCAATATTCCTATGACAATGTTCAGGCAACGATTCCAAGGATTAAGA
    AAAGATCAACCGGTATACTTATGTGATGCCAATGGGATTGCTAGCTATAGAGCCGCTCGT
    ATTTTGAAAAAGAATGGATATACAGATATCTATATGTTAAAAGGCGGCTATAAAAAATGG
    ACTGGAAAAATAAAGTCTAAAAAATAG
    60
    120
    180
    240
    300
    360
    387


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001524 [new locus tag: EGJ38_RS07610 ]
  • symbol: EGJ38_001524
  • description: rhodanese-like domain-containing protein
  • length: 128
  • theoretical pI: 10.4847
  • theoretical MW: 14803.3
  • GRAVY: -0.31875

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 24.1)
    phage shock operon rhodanese PspE (TIGR02981; EC 2.8.1.1; HMM-score: 23.1)
    thiazole biosynthesis domain (TIGR04271; HMM-score: 20.8)
    and 1 more
    PQQ-dependent catabolism-associated CXXCW motif protein (TIGR03865; HMM-score: 14.9)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 74)
    and 1 more
    no clan defined FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 20.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0005
    • Cytoplasmic Membrane Score: 0.9954
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.004
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.311086
    • TAT(Tat/SPI): 0.001625
    • LIPO(Sec/SPII): 0.009856
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423481 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGHINGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKWTGKIKSKK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [1]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]