Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1495 [new locus tag: SAUSA300_RS08160 ]
- pan locus tag?: SAUPAN004111000
- symbol: SAUSA300_1495
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1495 [new locus tag: SAUSA300_RS08160 ]
- symbol: SAUSA300_1495
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1648032..1648418
- length: 387
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913930 NCBI
- RefSeq: YP_494190 NCBI
- BioCyc: see SAUSA300_RS08160
- MicrobesOnline: 1293010 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAGTGCTAGTTTGTACATCGCAATAATTTTAGTTATAGCAATTATTGCTTATATGATT
GTTCAACAAATTCTTAACAAGCGAGCTGTTAAAGAATTAGATCAAAATGAATTCCATAAT
GGGATTAGAAAAGCTCAAGTCATCGATGTTAGAGAGAAAGTTGACTATGACTACGGTCAC
ATTAATGGGTCTCGCAATATTCCTATGACAATGTTCAGGCAACGATTCCAAGGATTAAGA
AAAGATCAACCGGTATACTTATGTGATGCCAATGGGATTGCTAGCTATAGAGCCGCTCGT
ATTTTGAAAAAGAATGGATATACAGATATCTATATGTTAAAAGGCGGCTATAAAAAATGG
ACTGGAAAAATAAAGTCTAAAAAATAG60
120
180
240
300
360
387
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1495 [new locus tag: SAUSA300_RS08160 ]
- symbol: SAUSA300_1495
- description: hypothetical protein
- length: 128
- theoretical pI: 10.4847
- theoretical MW: 14803.3
- GRAVY: -0.31875
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 24.1)phage shock operon rhodanese PspE (TIGR02981; EC 2.8.1.1; HMM-score: 23.1)thiazole biosynthesis domain (TIGR04271; HMM-score: 20.8)and 1 morePQQ-dependent catabolism-associated CXXCW motif protein (TIGR03865; HMM-score: 14.9)
- TheSEED :
- Rhodanese-like domain protein
Potassium metabolism Potassium metabolism - no subcategory Glutathione-regulated potassium-efflux system and associated functions Rhodanese-like domain proteinand 2 more - PFAM: Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 74)and 1 moreno clan defined FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 20.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0005
- Cytoplasmic Membrane Score: 0.9954
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.004
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.311086
- TAT(Tat/SPI): 0.001625
- LIPO(Sec/SPII): 0.009856
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGHINGSRNIPMTMFRQRFQGLRKDQPVYLCDANGIASYRAARILKKNGYTDIYMLKGGYKKWTGKIKSKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]