Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001559 [new locus tag: EGJ38_RS07785 ]
- pan locus tag?: SAUPAN004150000
- symbol: cdd
- pan gene symbol?: cdd
- synonym:
- alternate name: JSNZ_001559
- product: cytidine deaminase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001559 [new locus tag: EGJ38_RS07785 ]
- symbol: cdd
- product: cytidine deaminase
- replicon: chromosome
- strand: -
- coordinates: 1596504..1596908
- length: 405
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423516 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAGTTATCAACCTCATTATTTTCAAGAAGTTAGAAAAGCACAACAAGAATCATATTCG
CCATACAGTCAATTTAAAGTAGGGGCTTATTTAAAAACGAAAGACGGTAGAACTTTTTAT
GGTACCAATGTAGAAAATGCTTCTTATCCATTATCGATATGTGCTGAACGAGCTAGTTTG
GTATCGGCAATTTCTCAAGGATACAGACCAGGTGATTTTGAATCAATAACTGTAACCGTA
GATGCAGATAAACCGTCATCACCTTGTGGTGCATGTCGTCAAGTTTTGAAGGAATTATGT
GATGATGATATGCCTGTGTATATGACAAATCATAAAGGAGATATGGTTATGATGACAGTC
GCAGAGTTACTACCATTTGGATTTTCAGGAAAGGATTTAGAATAA60
120
180
240
300
360
405
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001559 [new locus tag: EGJ38_RS07785 ]
- symbol: Cdd
- description: cytidine deaminase
- length: 134
- theoretical pI: 4.87847
- theoretical MW: 14963.8
- GRAVY: -0.430597
⊟Function[edit | edit source]
- reaction: EC 3.5.4.5? ExPASyCytidine deaminase Cytidine + H2O = uridine + NH3 2'-deoxycytidine + H2O = 2'-deoxyuridine + NH3
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides cytidine deaminase (TIGR01354; EC 3.5.4.5; HMM-score: 170.6)and 2 morePurines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides cytidine deaminase (TIGR01355; EC 3.5.4.5; HMM-score: 55.1)phosphonate C-P lyase system protein PhnH (TIGR03292; HMM-score: 12.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: CDA (CL0109) dCMP_cyt_deam_1; Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383; HMM-score: 58.1)and 3 moredCMP_cyt_deam_2; Cytidine and deoxycytidylate deaminase zinc-binding region (PF08211; HMM-score: 38.7)LmjF365940-deam; LmjF365940 subfamily CDD/CDA-like deaminase (PF14421; HMM-score: 16.6)no clan defined DUF2685; Protein of unknown function (DUF2685) (PF10886; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9855
- Cytoplasmic Membrane Score: 0.0108
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0035
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.057189
- TAT(Tat/SPI): 0.002536
- LIPO(Sec/SPII): 0.001642
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423516 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASLVSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTVAELLPFGFSGKDLE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)