Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001585 [new locus tag: EGJ38_RS07915 ]
- pan locus tag?: SAUPAN004181000
- symbol: yhbY
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001585
- product: ribosome assembly RNA-binding protein YhbY
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001585 [new locus tag: EGJ38_RS07915 ]
- symbol: yhbY
- product: ribosome assembly RNA-binding protein YhbY
- replicon: chromosome
- strand: -
- coordinates: 1620953..1621243
- length: 291
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423542 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCTTACTGGCAAACAAAAAAGATACTTAAGAAGTTTAGCACACAATATTGATCCGATT
TTTCAAATTGGAAAAGGCGGTATCAACGAAAATATGATTAAACAAATAGATGATACGTTA
GAAAACAGAGAATTGATTAAAGTACATGTACTACAAAATAACTTTGATGATAAAAAAGAA
TTAGCTGAAACATTAAGCGAAGCTACGCATAGTGAATTAGTGCAAGTGATTGGATCTATG
ATAGTGATTTATAGAGAATCTAAAGATAATAAAGAAATTGAATTGCCATAA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001585 [new locus tag: EGJ38_RS07915 ]
- symbol: YhbY
- description: ribosome assembly RNA-binding protein YhbY
- length: 96
- theoretical pI: 5.65938
- theoretical MW: 11047.6
- GRAVY: -0.521875
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General putative RNA-binding protein, YhbY family (TIGR00253; HMM-score: 130)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined CRS1_YhbY; CRS1 / YhbY (CRM) domain (PF01985; HMM-score: 116)and 4 moreHMA (CL0704) HMA_2; Heavy metal associated domain 2 (PF19991; HMM-score: 16.4)no clan defined DUF1217; Protein of unknown function (DUF1217) (PF06748; HMM-score: 12.8)NADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 12.5)TIM_barrel (CL0036) Glyco_hydro_59; Glycosyl hydrolase family 59 (PF02057; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9894
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0
- Extracellular Score: 0.0102
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002297
- TAT(Tat/SPI): 0.00015
- LIPO(Sec/SPII): 0.000525
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423542 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)