From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001588 [new locus tag: EGJ38_RS07930 ]
  • pan locus tag?: SAUPAN004184000
  • symbol: EGJ38_001588
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_001588
  • product: YqeG family HAD IIIA-type phosphatase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001588 [new locus tag: EGJ38_RS07930 ]
  • symbol: EGJ38_001588
  • product: YqeG family HAD IIIA-type phosphatase
  • replicon: chromosome
  • strand: -
  • coordinates: 1623168..1623695
  • length: 528
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423545 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGGTTTAGTTCGCAAGTTTTTTATGCCGAATTCATATGTTCAATCAATATTTCAAATT
    GATTTAGACAAGTTAGTGGACAAAGGCGTTAAAGGTATTATTACAGATTTAGATAATACG
    CTAGTAGGTTGGGATGTTAAAGAACCTACAGAACGTGTTAAAGCATGGTTTAAGGAAGCT
    AATGAAAAAGGAATCACTATTACAATCGTGTCTAATAATAATGAGTCTCGTGTTGCTAGT
    TTTAGTCAGCATCTAGACATCGATTTTATTTTTAAAGCGAGAAAGCCAATGGGGAAAGCG
    TTTGATAAAGCAATAACTAAGATGAATATCAGACCAGATCAAACTGTTGTTATAGGTGAC
    CAAATGCTTACTGATGTATTTGGTGGTAATCGTCGAGGTCTATATACAATTATGGTTGTT
    CCAGTTAAACGAACTGATGGCTTTATTACTAAGTTTAATAGATTAATTGAAAGACGATTA
    TTACGTCATTTCAGTAAAAAAGGTTATATCACATGGGAGGAAAATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    528


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001588 [new locus tag: EGJ38_RS07930 ]
  • symbol: EGJ38_001588
  • description: YqeG family HAD IIIA-type phosphatase
  • length: 175
  • theoretical pI: 10.4084
  • theoretical MW: 20219.4
  • GRAVY: -0.305714

Function[edit | edit source]

  • TIGRFAM:
    HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 166.3)
    and 27 more
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IIIA (TIGR01662; HMM-score: 81.4)
    HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 40.4)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IIA (TIGR01460; HMM-score: 34.5)
    Unknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 34.2)
    noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 31.3)
    phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 29.8)
    HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 29)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 26.1)
    Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01457 family (TIGR01457; HMM-score: 23.6)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 23.4)
    histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 22.9)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IIB (TIGR01484; HMM-score: 22.2)
    HAD hydrolase, TIGR01459 family (TIGR01459; HMM-score: 22)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 21.4)
    Unknown function Enzymes of unknown specificity HAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 21.2)
    Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01458 family (TIGR01458; HMM-score: 21)
    HAD phosphatase, family IIIC (TIGR01681; HMM-score: 18.8)
    mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 18.1)
    HAD hydrolase, family IA, variant 2 (TIGR01493; HMM-score: 15.9)
    FkbH domain (TIGR01686; HMM-score: 15.9)
    sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 15)
    mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 14.8)
    beta-phosphoglucomutase family hydrolase (TIGR02009; HMM-score: 14.5)
    haloacid dehalogenase, type II (TIGR01428; EC 3.8.1.2; HMM-score: 13.8)
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 13.5)
    Metabolism Energy metabolism Biosynthesis and degradation of polysaccharides beta-phosphoglucomutase (TIGR01990; EC 5.4.2.6; HMM-score: 12.1)
    sucrose phosphatase (TIGR01485; EC 3.1.3.24; HMM-score: 11.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HAD (CL0137) Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 44.9)
    Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 39.5)
    HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 37.8)
    and 6 more
    PGP_phosphatase; Mitochondrial PGP phosphatase (PF09419; HMM-score: 34.9)
    Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 33.7)
    Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 20.1)
    E-set (CL0159) BsuPI; Intracellular proteinase inhibitor (PF12690; HMM-score: 14.1)
    HAD (CL0137) S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 13.6)
    no clan defined DUF6305; Domain of unknown function (DUF6305) (PF19823; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.171
    • Cytoplasmic Membrane Score: 0.8191
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0098
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003078
    • TAT(Tat/SPI): 0.000147
    • LIPO(Sec/SPII): 0.000352
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423545 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEANEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGDQMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]