From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1654 [new locus tag: SACOL_RS08435 ]
  • pan locus tag?: SAUPAN004184000
  • symbol: SACOL1654
  • pan gene symbol?:
  • synonym:
  • product: HAD superfamily hydrolase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1654 [new locus tag: SACOL_RS08435 ]
  • symbol: SACOL1654
  • product: HAD superfamily hydrolase
  • replicon: chromosome
  • strand: -
  • coordinates: 1683312..1683839
  • length: 528
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGGTTTAGTTCGCAAGTTTTTTATGCCGAATTCATATGTTCAATCAATATTTCAAATT
    GATTTAGACAAGTTAGTGGACAAAGGCGTTAAAGGTATTATTACAGATTTAGATAATACG
    CTAGTAGGTTGGGATGTTAAAGAACCTACAGAACGTGTTAAAGCATGGTTTAAGGAAGCT
    AATGAAAAAGGAATCACTATTACAATCGTGTCTAATAATAATGAGTCTCGTGTTGCTAGT
    TTTAGTCAGCATTTAGACATCGATTTTATTTTTAAAGCGAGAAAGCCAATGGGGAAAGCG
    TTTGATAAAGCAATAACTAAGATGAATATCAGACCAGATCAAACTGTTGTTATAGGTGAC
    CAAATGCTTACTGATGTATTTGGTGGTAATCGTCGAGGTCTATATACAATTATGGTTGTT
    CCAGTTAAACGAACTGATGGCTTTATTACTAAGTTTAATAGATTAATTGAAAGACGATTA
    TTACGTCATTTCAGTAAAAAAGGTTATATCACATGGGAGGAAAATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    528

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1654 [new locus tag: SACOL_RS08435 ]
  • symbol: SACOL1654
  • description: HAD superfamily hydrolase
  • length: 175
  • theoretical pI: 10.4084
  • theoretical MW: 20219.4
  • GRAVY: -0.305714

Function[edit | edit source]

  • TIGRFAM:
    HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 166.3)
    and 27 more
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IIIA (TIGR01662; HMM-score: 81.4)
    HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 40.4)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IIA (TIGR01460; HMM-score: 34.5)
    Unknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 34.2)
    noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 31.3)
    phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 29.8)
    HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 29)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 26.1)
    Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01457 family (TIGR01457; HMM-score: 23.6)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 23.4)
    histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 22.9)
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IIB (TIGR01484; HMM-score: 22.2)
    HAD hydrolase, TIGR01459 family (TIGR01459; HMM-score: 22)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 21.4)
    Unknown function Enzymes of unknown specificity HAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 21.2)
    Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01458 family (TIGR01458; HMM-score: 21)
    HAD phosphatase, family IIIC (TIGR01681; HMM-score: 18.8)
    mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 18.1)
    HAD hydrolase, family IA, variant 2 (TIGR01493; HMM-score: 15.9)
    FkbH domain (TIGR01686; HMM-score: 15.9)
    sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 15)
    mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 14.8)
    beta-phosphoglucomutase family hydrolase (TIGR02009; HMM-score: 14.5)
    haloacid dehalogenase, type II (TIGR01428; EC 3.8.1.2; HMM-score: 13.8)
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 13.5)
    Metabolism Energy metabolism Biosynthesis and degradation of polysaccharides beta-phosphoglucomutase (TIGR01990; EC 5.4.2.6; HMM-score: 12.1)
    sucrose phosphatase (TIGR01485; EC 3.1.3.24; HMM-score: 11.7)
  • TheSEED  :
    • FIG001553: Hydrolase, HAD subfamily IIIA
  • PFAM:
    HAD (CL0137) HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 38.7)
    Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 35.2)
    Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 34)
    PGP_phosphatase; Mitochondrial PGP phosphatase (PF09419; HMM-score: 32.8)
    and 4 more
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 26.1)
    Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 16.7)
    Glyco_hydro_tim (CL0058) Cellulase; Cellulase (glycosyl hydrolase family 5) (PF00150; HMM-score: 13.5)
    HAD (CL0137) S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003078
    • TAT(Tat/SPI): 0.000147
    • LIPO(Sec/SPII): 0.000352
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEANEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGDQMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 61 [3]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]