Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001671 [new locus tag: EGJ38_RS08345 ]
- pan locus tag?: SAUPAN004308000
- symbol: nrdR
- pan gene symbol?: nrdR
- synonym:
- alternate name: JSNZ_001671
- product: transcriptional regulator NrdR
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001671 [new locus tag: EGJ38_RS08345 ]
- symbol: nrdR
- product: transcriptional regulator NrdR
- replicon: chromosome
- strand: -
- coordinates: 1704854..1705324
- length: 471
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423627 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAATGCCCGAAATGTAATTCTACACAATCTAAAGTTGTAGATTCAAGGCATGCCGAT
GAATTAAATGCCATTCGAAGACGAAGAGAATGTGAAAATTGTGGAACACGTTTCACTACA
TTTGAACATATCGAAGTTAGTCAGCTTATAGTTGTGAAAAAAGATGGCACAAGAGAGCAG
TTTTCAAGAGAAAAGATACTTAATGGACTTGTGCGTTCTTGTGAGAAACGACCAGTTAGA
TATCAACAACTTGAAGACATAACTAACAAGGTTGAATGGCAATTACGAGATGAAGGTCAT
ACGGAAGTGTCTTCACGAGATATAGGTGAACACGTTATGAACTTGTTAATGCATGTTGAT
CAAGTTTCATATGTTAGATTTGCATCAGTCTATAAAGAATTTAAAGATGTTGATCAATTG
TTAGCATCGATGCAAGGGATTTTAAGCGAAAACAAACGGAGTGATGCTTAA60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001671 [new locus tag: EGJ38_RS08345 ]
- symbol: NrdR
- description: transcriptional regulator NrdR
- length: 156
- theoretical pI: 7.89688
- theoretical MW: 18203.5
- GRAVY: -0.744872
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator NrdR (TIGR00244; HMM-score: 187.7)and 4 moreCys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 16.4)Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 14.6)MJ0042 family finger-like domain (TIGR02098; HMM-score: 12)cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.7)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 77.7)Zn_Beta_Ribbon (CL0167) Zn_ribbon_NrdR; Transcriptional repressor NrdR-like, N-terminal domain (PF22811; HMM-score: 72.3)and 18 moreC2H2-zf (CL0361) zf-DBF; DBF zinc finger (PF07535; HMM-score: 19.5)Zn_Beta_Ribbon (CL0167) Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 16.3)no clan defined DUF7117; Family of unknown function (DUF7117) (PF23430; HMM-score: 15.4)Zn_Beta_Ribbon (CL0167) Zn_ribbon_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 15)Zn_ribbon_GRF_2; GRF-like zinc ribbon domain (PF23549; HMM-score: 14.7)Zn_ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 14.1)Zn_ribbon_5; zinc-ribbon domain (PF13719; HMM-score: 14.1)DUF7129; Domain of unknown function (DUF7129) (PF23455; HMM-score: 13.3)Zn_ribbon_Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 13.1)Zn_ribbon_TFIIS; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 12.6)Ogr_Delta; Ogr/Delta-like zinc finger (PF04606; HMM-score: 11.9)no clan defined DUF7351; Domain of unknown function (DUF7351) (PF24042; HMM-score: 11.7)C2H2-zf (CL0361) zf-C2H2; Zinc finger, C2H2 type (PF00096; HMM-score: 11.4)Zn_Beta_Ribbon (CL0167) Zn_ribbon_PaaD; PaaD zinc beta ribbon domain (PF23451; HMM-score: 11.3)Zn_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 10.7)Zn_Ribbon_1; zinc-ribbon domain (PF13240; HMM-score: 9.7)no clan defined RUBY_RBDX; Rubrerythrin, rubredoxin-like domain (PF21349; HMM-score: 9.3)HEWD; HEWD domain (PF20576; HMM-score: 8.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Deoxyribonucleotides
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9776
- Cytoplasmic Membrane Score: 0.0025
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0198
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016516
- TAT(Tat/SPI): 0.00067
- LIPO(Sec/SPII): 0.005624
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423627 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQFSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVDQVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)