Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1733 [new locus tag: SACOL_RS08860 ]
- pan locus tag?: SAUPAN004308000
- symbol: nrdR
- pan gene symbol?: nrdR
- synonym:
- product: transcriptional regulator NrdR
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1733 [new locus tag: SACOL_RS08860 ]
- symbol: nrdR
- product: transcriptional regulator NrdR
- replicon: chromosome
- strand: -
- coordinates: 1764387..1764857
- length: 471
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238711 NCBI
- RefSeq: YP_186570 NCBI
- BioCyc: see SACOL_RS08860
- MicrobesOnline: 913179 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAATGCCCGAAATGTAATTCTACACAATCTAAAGTTGTAGATTCAAGGCATGCCGAT
GAATTAAATGCCATTCGAAGACGAAGAGAATGTGAAAATTGTGGAACACGTTTCACTACA
TTTGAACATATCGAAGTTAGTCAGCTTATAGTTGTGAAAAAAGATGGCACAAGAGAGCAG
TTTTCAAGAGAAAAGATACTTAATGGACTTGTGCGTTCTTGTGAGAAACGACCAGTTAGA
TATCAACAACTTGAAGACATAACTAACAAGGTTGAATGGCAATTACGAGATGAAGGTCAT
ACGGAAGTGTCTTCACGAGATATAGGTGAACACGTTATGAACTTGTTAATGCATGTTGAT
CAAGTTTCATATGTTAGATTTGCATCAGTCTATAAAGAATTTAAAGATGTTGATCAATTG
TTAGCATCGATGCAAGGGATTTTAAGCGAAAACAAACGGAGTGATGCTTAA60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1733 [new locus tag: SACOL_RS08860 ]
- symbol: NrdR
- description: transcriptional regulator NrdR
- length: 156
- theoretical pI: 7.89688
- theoretical MW: 18203.5
- GRAVY: -0.744872
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator NrdR (TIGR00244; HMM-score: 187.7)and 4 moreCys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 16.4)Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 14.6)MJ0042 family finger-like domain (TIGR02098; HMM-score: 12)cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.7)
- TheSEED :
- Ribonucleotide reductase transcriptional regulator NrdR
- PFAM: no clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 77.7)Zn_Beta_Ribbon (CL0167) Zn_ribbon_NrdR; Transcriptional repressor NrdR-like, N-terminal domain (PF22811; HMM-score: 72.3)and 18 moreC2H2-zf (CL0361) zf-DBF; DBF zinc finger (PF07535; HMM-score: 19.5)Zn_Beta_Ribbon (CL0167) Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 16.3)no clan defined DUF7117; Family of unknown function (DUF7117) (PF23430; HMM-score: 15.4)Zn_Beta_Ribbon (CL0167) Zn_ribbon_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 15)Zn_ribbon_GRF_2; GRF-like zinc ribbon domain (PF23549; HMM-score: 14.7)Zn_ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 14.1)Zn_ribbon_5; zinc-ribbon domain (PF13719; HMM-score: 14.1)DUF7129; Domain of unknown function (DUF7129) (PF23455; HMM-score: 13.3)Zn_ribbon_Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 13.1)Zn_ribbon_TFIIS; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 12.6)Ogr_Delta; Ogr/Delta-like zinc finger (PF04606; HMM-score: 11.9)no clan defined DUF7351; Domain of unknown function (DUF7351) (PF24042; HMM-score: 11.7)C2H2-zf (CL0361) zf-C2H2; Zinc finger, C2H2 type (PF00096; HMM-score: 11.4)Zn_Beta_Ribbon (CL0167) Zn_ribbon_PaaD; PaaD zinc beta ribbon domain (PF23451; HMM-score: 11.3)Zn_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 10.7)Zn_Ribbon_1; zinc-ribbon domain (PF13240; HMM-score: 9.7)no clan defined RUBY_RBDX; Rubrerythrin, rubredoxin-like domain (PF21349; HMM-score: 9.3)HEWD; HEWD domain (PF20576; HMM-score: 8.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Zn2+
- effector: Deoxyribonucleotides
- genes regulated by NrdR, TF important in Deoxyribonucleotide biosynthesisRegPrecisetranscription unit transferred from N315 data RegPrecise
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9776
- Cytoplasmic Membrane Score: 0.0025
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0198
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016516
- TAT(Tat/SPI): 0.00067
- LIPO(Sec/SPII): 0.005624
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQFSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVDQVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 92 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: dnaI < SACOL1732 < nrdR
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)