Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001856 [new locus tag: EGJ38_RS09265 ]
- pan locus tag?: SAUPAN004793000
- symbol: glnQ
- pan gene symbol?: glnQ
- synonym:
- alternate name: JSNZ_001856
- product: amino acid ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001856 [new locus tag: EGJ38_RS09265 ]
- symbol: glnQ
- product: amino acid ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1893981..1894703
- length: 723
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423797 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721GTGATTAAAATAAACAATCTTAATAAAGTTTTTGGAGATAATGAAGTTTTAAAAGATATC
AATCTTGAAATCAATCAAGGGGAAGTAGTAGCAATAATAGGTCCATCTGGTAGTGGTAAA
AGTACATTGTTAAGATGTATGAATTTATTAGAAGTACCCACTAAAGGTCAAGTGATTTTT
GAAGGCAATGACTTAACGGAAAAAGGGACACAAGTAGATAAACTACGTCAAAAAATGGGT
ATGGTATTTCAAAACTTCAACCTATTTCCACATAAAAAAGTTGTCGATAATATTATTTTA
GCTCCTAAATTATTAAAGAAAGATAATAACGATGAATTACATAAGGAAGCATTGTCGTTA
TTAGATAAAGTGGGATTAAAAGAAAAAGCAGATGTATATCCGAATCAATTATCAGGTGGT
CAAAAGCAAAGGGTAGCAATTGCAAGAGCTTTAGCAATGCATCCAGATGTTATTTTATTC
GATGAACCAACTTCAGCATTAGATCCTGAGGTAGTTGGTGATGTATTAAAAGTAATGAAA
GACCTAGCCAAAGAAGGTATGACCATGGTGGTTGTGACACATGAAATGGGATTTGCCAAA
GATGTAAGTGACAAAGTTATATTTATGGCAGATGGCGTTGTCGTAGAGTCAGGCACACCA
GTCGAAATATTTGAACAACCGCAACATGAAAGAACACAAAATTTCTTAGCAAGAGTATTA
TAA60
120
180
240
300
360
420
480
540
600
660
720
723
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001856 [new locus tag: EGJ38_RS09265 ]
- symbol: GlnQ
- description: amino acid ABC transporter ATP-binding protein
- length: 240
- theoretical pI: 5.70084
- theoretical MW: 26571.7
- GRAVY: -0.132083
⊟Function[edit | edit source]
- TIGRFAM: ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 292.8)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 273.3)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 234.4)and 78 moreTransport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 227.3)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 219.1)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 218.9)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 215)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 199.6)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 198.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 195)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 194.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189.1)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189.1)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 184.8)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 182.9)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 173.3)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 162.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 161.2)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 158.4)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 156.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 149.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 149.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 148.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 145.7)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 145.2)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 144)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 138.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 136.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 134.1)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 132.9)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 132.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 128.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 124)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 122.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 119)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 114.9)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 114.6)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 111.4)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.3)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.3)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 109.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 107.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 104.6)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 98)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 93.2)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 92.7)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 90.1)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 83.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 83.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 76.2)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 57.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 56)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 48.6)rad50 (TIGR00606; HMM-score: 17)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 14.1)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 13)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 12.9)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.4)Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.4)Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 141.1)and 34 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 48.7)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 44.4)ABC_ATPase; P-loop domain (PF09818; HMM-score: 28)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 26.2)AAA_23; AAA domain (PF13476; HMM-score: 23.1)nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 20.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.9)AAA_15; AAA ATPase domain (PF13175; HMM-score: 19.5)AAA_22; AAA domain (PF13401; HMM-score: 18.9)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.4)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 15.8)AAA_18; AAA domain (PF13238; HMM-score: 15.5)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 14.8)AAA_25; AAA domain (PF13481; HMM-score: 14.8)AAA_30; AAA domain (PF13604; HMM-score: 14.6)AAA_33; AAA domain (PF13671; HMM-score: 14.6)AAA_13; AAA domain (PF13166; HMM-score: 14.5)ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 14.5)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 14.4)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.3)NADP_Rossmann (CL0063) Methyltransf_17; S-adenosyl-L-methionine methyltransferase (PF12692; HMM-score: 13.9)P-loop_NTPase (CL0023) Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 13.8)NACHT; NACHT domain (PF05729; HMM-score: 13.6)AAA_24; AAA domain (PF13479; HMM-score: 13.6)AAA_28; AAA domain (PF13521; HMM-score: 13.6)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.4)NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.9)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.5)AAA_14; AAA domain (PF13173; HMM-score: 12.4)Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.3)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 12.1)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 11.7)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1099
- Cytoplasmic Membrane Score: 0.7704
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.1195
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006829
- TAT(Tat/SPI): 0.000261
- LIPO(Sec/SPII): 0.000465
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423797 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQVIFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEALSLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKVMKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLARVL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ 2.0 2.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)